KEGG   Sphingopyxis alaskensis: Sala_0630Help
Entry
Sala_0630         CDS       T00361                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sal  Sphingopyxis alaskensis
Brite
KEGG Orthology (KO) [BR:sal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sala_0630
Enzymes [BR:sal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sala_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_binding_3 NAD_binding_7 Thi4 Glutaredoxin NAD_binding_8 DAO FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABF52351
UniProt: Q1GVH1
LinkDB All DBs
Position
640393..641955
Genome map
AA seq 520 aa AA seqDB search
MPMLDPNTTAQLKTYLGNLRHPIELVASLDASPKSVEMRALVEEVAAQSDRITARFDGDD
VRRPSFAIRGDEGKAEAVFAGLPMGHEFTSLILALLHVGGHPPKEDAELLDAVRALEGDF
TFETFFSLSCQNCPDVVQALNIMAALNPNIRHTAIDGALFQDEVERRQVMAVPAVFLNGE
PFGQGRMDLAQIVAKLDAGAVARAAGKIAAKEPFDVLVVGGGPGGAAAAIYAARKGIRTG
IVAERFGGQLLDTLGIDNFVSVQHTEGPKLAAQLEAHVKDYDVDVMNAQEAAALIPGGAN
GLHEVKLKSGASVKGKTVILSTGARWRQMGVPGEAEYRGRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVAHVTLIEFDSQLRADAVLQTKLGSLPNVTVITSALTTEVLGN
GEKVVGLRYRDRGTDEEHLIELEGIFVQIGLVPNTEWLGDAVALSGRGEIEVDARGATSQ
PGIFAAGDVTTVPYKQIVIAMGEGSKASLSAFDHLIRAGA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgctcgaccccaacacgaccgcccagctcaaaacctatctcggcaacctccgc
cacccgatcgagctggtcgcgagcctcgatgcctcgcccaagtcggtcgagatgcgcgcg
cttgtcgaagaggtcgcggcgcagtcggaccgcatcaccgcgcgcttcgacggcgacgac
gtacgtcgtccgtccttcgcgattcgcggcgatgagggcaaagccgaagccgtgttcgcc
ggcctgccgatggggcatgagtttacgtcgctgatcctcgcgctgctgcatgtcggcggc
cacccgccgaaggaagacgccgaactgctcgacgcggtgcgtgcgctggagggcgatttc
accttcgaaaccttcttttcgctgtcgtgccagaattgccccgacgtcgtgcaggcgctc
aacatcatggcggcgctcaatccgaatatccgccacaccgcgatcgacggcgcgctgttc
caggacgaggtcgaacggcgtcaggtgatggcggtgcccgcggtgttcctgaacggcgaa
cctttcgggcaggggcgcatggacctcgcgcagatcgtcgcgaaactcgacgccggtgcc
gtcgcccgcgcggccggaaagatcgccgcgaaggagccgttcgacgtgctcgtcgtcggc
ggcggacccggcggcgctgcggcggcgatttatgcggcgcgcaagggcatccgcaccggc
atcgtcgccgaacgtttcggcgggcagctgctcgacacgctggggatcgacaatttcgtc
tcggtccagcacaccgaaggcccgaagctcgccgcgcaactcgaagcgcatgtcaaggat
tatgacgtcgatgtgatgaacgcgcaggaagccgccgcgctgatccccggcggcgcgaac
ggcctgcacgaggtgaagctgaaaagcggcgcgagcgtcaaggggaagaccgtcatcctg
tcgaccggcgcgcgctggcgccagatgggcgtccccggcgaggccgaatatcggggcagg
ggcgtcgcctattgcccgcattgcgacggtccgctgttcaagggcaagcgcgtcgcggtg
atcggcggcggcaattcgggggtcgaggcggcgatcgatctggccgggctggtcgcgcat
gtgaccttgatcgagttcgacagccagcttcgcgctgacgcggtgcttcagacgaagctc
ggcagcctgcccaatgtcaccgtcattacgtcggcgctcaccaccgaagtgctcggcaat
ggcgaaaaggtcgtcgggctgcgctatcgcgaccgcggcacggacgaggagcatctgatc
gaactcgaaggcattttcgtccagatcggccttgtccccaacaccgaatggctcggcgat
gcggtggcgctcagcggtcgcggcgagatcgaggtcgacgcgcgcggcgcgaccagccag
cccggcattttcgccgcgggtgacgtgacgacggtgccctacaagcagatcgtcatcgcg
atgggcgaggggtcaaaggcgtcgctctcggccttcgaccatctgattcgcgcgggcgcc
tga

DBGET integrated database retrieval system