KEGG   Sphingopyxis alaskensis: Sala_2778Help
Entry
Sala_2778         CDS       T00361                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sala_2778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sal02000]
    Sala_2778
Enzymes [BR:sal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Sala_2778
Transporters [BR:sal02000]
 Other Transporters
  Pores ion channels [TC:1]
   Sala_2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ABF54483
UniProt: Q1GPD9
LinkDB All DBs
Position
2934474..2935109
Genome map
AA seq 211 aa AA seqDB search
MADELIFYTNPMSRGQIVRWMLEEVGAPYEPRILDYGTTMKEAAYLAVNPMGKVPAIVHN
GKVVTECAAICAYLADAFPDKGLAPALTGRADYYRWLFFTAGPVEQAITAKMFGFEPDAE
QQRMAGFGSLAAALDALESAVSGKSFIAGDHFSAADVYVGSQIDWGLQFGTIASRPAFEA
YIAPLRERVAYKRAKDIDNALIAEMQAANPA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgagctgattttctataccaaccccatgtcgcgcgggcagatcgtccgctgg
atgctcgaagaggtcggcgcaccctatgaaccgcgcattctcgattatggcacgacgatg
aaggaggcggcctatctggcggtgaacccgatgggcaaggttccggcgatcgtccacaat
ggcaaggtggtgaccgaatgcgcggcaatctgcgcctatctggccgatgccttccccgac
aaggggctcgcgcccgcgctcaccgggcgcgccgattattatcgctggcttttctttacc
gcggggccggtcgagcaggcgatcaccgcgaagatgttcgggtttgaacccgatgccgag
cagcagcgcatggcgggcttcggttcgctcgccgcggcgctcgacgcgctggagagcgcg
gtttcgggcaagtcgttcatcgctggcgaccatttcagcgccgcggacgtctatgtcggc
agccagatcgactgggggctgcaattcgggacgatcgcatcgcgcccggctttcgaggcc
tatattgcgcctctgcgcgaacgcgtggcgtacaagcgcgcgaaggacatcgacaatgcg
ctgatcgccgagatgcaggccgccaatccggcgtag

DBGET integrated database retrieval system