KEGG   Salinibacterium sp. UTAS2018: ESZ53_08730Help
Entry
ESZ53_08730       CDS       T05816                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
sala  Salinibacterium sp. UTAS2018
Pathway
sala00250  Alanine, aspartate and glutamate metabolism
sala00280  Valine, leucine and isoleucine degradation
sala00310  Lysine degradation
sala00410  beta-Alanine metabolism
sala00640  Propanoate metabolism
sala00650  Butanoate metabolism
sala01100  Metabolic pathways
sala01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ESZ53_08730 (gabT)
   00650 Butanoate metabolism
    ESZ53_08730 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ESZ53_08730 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ESZ53_08730 (gabT)
   00310 Lysine degradation
    ESZ53_08730 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ESZ53_08730 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sala01007]
    ESZ53_08730 (gabT)
Enzymes [BR:sala01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ESZ53_08730 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ESZ53_08730 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     ESZ53_08730 (gabT)
Amino acid related enzymes [BR:sala01007]
 Aminotransferase (transaminase)
  Class III
   ESZ53_08730 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 ORC2
Motif
Other DBs
NCBI-ProteinID: QAV70514
UniProt: A0A410YJ83
LinkDB All DBs
Position
1836147..1837523
Genome map
AA seq 458 aa AA seqDB search
MSTSSSSTTTSAPTVPVGGPSLPQKRDLVTAIPGPRSLELLERKKQSVAAAIGITLPVFV
EAAGGGVLRDVDGNTLIDFGSGIAVTGVGNSAPAVVEAVTAQVAQFTHTCFMINGYESYI
EVAEKLNEITPGTHEKRTALFNSGAEAVENAIKIARYFTGKQAVVAFDHAYHGRTNLTMG
LTAKSMPYKSGFGPFASEIYRAPMSYPFRDGGISGEDAAARAILQIEKQVGASNLAAIII
EPIQGEGGFIEPAPGFLPALAEWATANNVIFIADEVQTGFARTGDLFASNHENLVPDIMV
TAKGIAGGLPLSAVTGRADVMDAAHVGGLGGTYGGNPIACAAALATIRTFEESGAIERAR
EIGTIFRGRLNGLRAGDPRIGDVRGRGAMIAMELVDPTTKEPDAALTSKVAAAAHAAGVV
VLTCGTYGNVIRFLPPLSISGELIADGLDVVRDALANA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttcttcttccagcaccacgactagtgcacccaccgttccggtcggcggcccc
tcgcttccgcagaagcgcgacctcgtcaccgcgatccccggaccccgctcgctcgaactg
ctcgagcgcaagaagcagtccgtcgccgccgcgatcggcatcactcttcccgtcttcgtc
gaagctgccggtggtggcgtgcttcgcgacgttgacggcaacaccctcatcgacttcggt
tccggcatcgccgtgaccggcgtcggcaactcggcccccgccgttgtcgaagccgtcacc
gctcaggtcgcccagttcacccacacctgcttcatgatcaacggctacgagagctacatc
gaggtcgccgagaagctcaacgagatcacccccggcacgcacgagaagcgcaccgcgctg
ttcaactcgggcgccgaagccgtcgagaacgcaatcaagatcgcccgctacttcaccggc
aagcaggccgttgttgccttcgatcacgcgtaccacggtcgcaccaacctcacgatgggc
ctcaccgccaagtcgatgccctacaagagcggcttcggtccgttcgcgtcggagatctac
cgcgccccgatgtcatacccgttccgcgatggcggaatcagtggtgaggatgccgccgcc
cgcgccatcctgcagatcgagaagcaggtcggcgccagcaacctcgccgcgatcatcatc
gagcccatccagggcgagggtggcttcattgagcccgctcccggattcctcccggcactc
gccgagtgggccacggccaacaacgtgatcttcatcgctgacgaagtgcagaccggcttc
gctcgcacgggagacctcttcgcctccaaccacgagaaccttgttcccgacatcatggtg
accgccaagggcatcgccggcggccttccgctttcggctgtcaccggccgtgccgacgtc
atggatgccgcccacgtcggcggactcggcggaacgtacggtggaaaccccatcgcctgt
gccgcagcgctcgccaccatccgcaccttcgaagagtcgggcgccatcgagcgtgcccgc
gaaatcggaaccatcttccgcggccgcctcaacggcctccgtgccggcgacccccgcatc
ggagatgttcgtggccgcggcgcgatgatcgccatggaactcgtcgaccccaccacgaaa
gagcccgacgccgcccttacatcgaaggtcgcggctgcagcgcacgccgccggcgttgtc
gtgctgacctgtggaacctatggcaacgtcatccgcttcctgccgccgctgtcgatctct
ggcgagctcatcgctgacggcctcgacgtcgtgcgcgacgctctcgccaacgcctga

DBGET integrated database retrieval system