KEGG   Streptomyces albus J1074: XNR_0119Help
Entry
XNR_0119          CDS       T02545                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
salb  Streptomyces albus J1074
Pathway
salb00250  Alanine, aspartate and glutamate metabolism
salb00410  beta-Alanine metabolism
salb00430  Taurine and hypotaurine metabolism
salb00650  Butanoate metabolism
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01120  Microbial metabolism in diverse environments
salb02024  Quorum sensing
Module
salb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    XNR_0119
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XNR_0119
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XNR_0119
   00430 Taurine and hypotaurine metabolism
    XNR_0119
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    XNR_0119
Enzymes [BR:salb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     XNR_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGI86524
UniProt: D6B201
LinkDB All DBs
Position
139523..140947
Genome map
AA seq 474 aa AA seqDB search
MSAAGGETSDGARLSLNPFHLAADPAAAMLSVPPVRRLSAHSLPPEVARRILHDEVMLDG
NARQNLATFVTTWMEPEGAAVMAECRDKNLIDKDEYPRTAEIERRCVAILADLWHAPDAD
RAVGCSTTGSSEACMLAGMAMKRRWAHRHGDRYPASARPNLVMGINVQVCWEKFCDYWEV
EPRMVPMEGERFHLDPQAAADLCDENTIGVVGILGSTYDGSYEPVQELCAALDALQERTG
WDVPVHVDGASGAMVAPFLDPDLVWDFRLERVVSINTSGHKYGLVYPGVGWAVWRSAEYL
PDDLVFRVDYLGGTMPTFALNFSRPGSQVAAQYYVFLRLGREGFRQVQQAGRDIATHLAH
GIEELGDFRLLTRGDQLPAFAFTTGADVRAYDVFDVSRRLRETGWLVPAYTCPPHRQDLS
VLRIVCRNGFTRDLADMLLHDLGRLLPELRRQSPHPGERPSPSTAFHHSAERGR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggcgggcggggagacgtcggacggcgcgcggctctccctcaatccgttccac
ctggcggccgacccggccgccgcgatgctgtcggtgccgccggtcaggaggctcagcgcc
cattcgctgccgccggaggtggcccggcggatcctgcacgacgaggtgatgctcgacggg
aacgcgcggcagaacctcgccaccttcgtgacgacctggatggagcccgagggcgcggcg
gtgatggcggagtgccgcgacaagaacctcatcgacaaggacgagtacccgcgcaccgcg
gagatcgagcgccggtgcgtggcgatcctcgccgacctctggcacgcccccgacgcggac
cgggcggtgggctgttccaccaccgggtcgagcgaggcgtgcatgctcgcggggatggcg
atgaagcggcgctgggcgcaccggcacggcgaccgctatcccgcctcggcccggcccaat
ctggtcatgggcatcaacgtccaggtctgctgggagaagttctgcgactactgggaggtc
gagccccggatggtgccgatggagggcgagcgcttccacctcgacccgcaggccgccgcc
gacctctgcgacgagaacaccatcggcgtggtcggcatcctcggctccacgtacgacggt
tcgtacgagccggtccaggagctctgcgcggcgctggacgctctccaggagcgcaccggc
tgggacgtgccggtccacgtcgacggggcgtcgggggccatggtcgcccccttcctcgac
ccggacctggtctgggacttccgcctggagcgggtcgtctccatcaacacctcgggccac
aagtacgggctggtctaccccggcgtggggtgggcggtgtggcgcagcgccgagtacctc
ccggacgacctggtcttccgcgtcgactacctcggcgggacgatgcccaccttcgccctg
aacttctcccgccccggctcccaggtggccgcccagtactacgtcttcctgcggctgggg
cgtgagggcttccgccaggtgcagcaggccggccgcgacatcgccacgcacctggcgcac
ggcatcgaggaactgggcgacttccggctgctgacccggggcgaccagctgcccgccttc
gccttcaccacgggggcggacgtgcgggcgtacgacgtcttcgacgtgtcgcggcggctg
cgcgagaccgggtggctggtgcccgcgtacacctgtccgccgcaccgtcaggacctctcc
gtgctgcggatcgtctgccgcaacggcttcacccgcgacctcgcggacatgctcctgcac
gacctggggcggctgctgccggagctgcggcgccagtccccgcaccccggggagcggccg
tcgcccagcacggccttccaccattcggcggagcggggccggtag

DBGET integrated database retrieval system