KEGG   Streptomyces albidoflavus: XNR_0140Help
Entry
XNR_0140          CDS       T02545                                 

Definition
(GenBank) sugar transporter
Organism
salb  Streptomyces albidoflavus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_2 MFS_4
Motif
Other DBs
NCBI-ProteinID: AGI86545
UniProt: D6B1Y0
LinkDB All DBs
Position
165963..167375
Genome map
AA seq 470 aa AA seqDB search
MSQGFSREPGTHGPLEEVPKRAARKITLWAVAIALGGFLFGFDTGVISGALLYIREDFAL
SSLEQSSVVSVLLIGAVVGSMLSGKLADRIGRRRTLGLVGLVFLGGTAVVTFADGFLMLL
TGRIVLGLSVGAASATVPVYLSEISPPAIRGRLLTLNQLMITVGILVAYLVNLAFSASEQ
WRAMFAVGAVPSALLVAATLWLLPESPQWLITHGRSEVAHRGITALIGKDTADEIVHRAQ
RRAEEERAAREKNAGRKKLLAPDVRPALVIGLTLAAVQQLGGINTIIYYAPTIIEQTGLS
SSNSILYSVCIGVINLVMTLVALRLVDRAGRRPMVLVSLALMAVSVFLLGLSFVVELGSG
LTLLFMVVYIAAYAGGLGPVFWTLIGEIFPPSVRAEGSSVSTTVNWVSNFAVSLTFLPLA
SALGQGETFWIFAAICVLAFLFVARYLPETKGRDADEIDRALHQRFRSRP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagggcttctcccgcgaacccggtacgcacggccccctcgaagaggtcccgaag
cgggcagcccggaagatcaccttgtgggcggtcgcgatcgcactgggcggcttcctcttc
ggcttcgacaccggtgtcatctccggcgcactgctctacatccgggaggacttcgcgctc
agctccctggagcagagcagcgtcgtcagcgtgctgctgatcggcgcggtcgtcggctcc
atgctgagcgggaagctggccgaccggatcggccggcgccggaccctcggcctggtcggt
ctggtcttcctgggcgggacggcggtcgtcaccttcgccgacggcttcctcatgctgctg
accggccggatcgtgctcgggctctcggtgggggccgcctcggcgacggtgccggtctac
ctctcggagatctcgcccccggcgatccgcgggcggctgctcaccctcaaccagctgatg
atcaccgtgggcatcctcgtcgcctacctcgtcaacctcgccttctccgccagtgagcag
tggcgggcgatgttcgcggtgggcgcggtcccctcggcgctgctggtcgccgccacgctc
tggctgctgccggagtcgccgcagtggctcatcacccacgggcggtccgaggtggcgcac
cggggcatcaccgcgctcatcgggaaggacacggccgacgagatcgtccaccgcgcacag
cggcgggcggaggaggagcgcgcggcacgggagaagaacgccggccgcaagaagctgctg
gcaccggacgtgcgaccggccctggtcatcggcctgaccctcgcagcggtccagcagctg
ggcgggatcaacacgatcatctactacgcccccaccatcatcgaacagaccggtctcagc
tcgtccaactcgatcctgtactcggtctgcatcggcgtgatcaacctggtgatgaccctg
gtggcgctccgcctggtcgaccgggccgggcggcgccccatggtgctggtctcgctcgcg
ctgatggcggtctcggtcttcctgctgggcctgtcgttcgtcgtggagctgggctcgggg
ctgacgctgctcttcatggtggtgtacatcgcggcctacgcgggcggtctgggcccggtg
ttctggaccctgatcggcgagatcttcccgccctccgtacgcgccgagggctccagtgtc
tccaccaccgtcaactgggtgtcgaacttcgcggtgagcctgaccttcctccccctggcc
tccgcgctcggccagggcgagaccttctggatcttcgccgcgatctgcgtcctcgccttc
ctcttcgtcgccaggtacctcccggagaccaagggccgcgacgccgatgagatcgaccgg
gccctccaccagcgcttcaggtcgcggccgtag

DBGET integrated database retrieval system