KEGG   Streptomyces albidoflavus: XNR_0334Help
Entry
XNR_0334          CDS       T02545                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
salb  Streptomyces albidoflavus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AGI86737
LinkDB All DBs
Position
404370..405437
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVKPMLAKSVARIPPGMQYEAKWDGFRALVFRDGPELELGSRTGKTLTRYFPE
LVAALLERLPERCVVDGEIVMARDGRLDFELLSERIHPAASRVRMLAERNPASFVAFDLL
ALGDEDLTTRPLTARRALLEEELGEAAPPLHVAPATRDPELAERWFDRFEGAGLDGVVAK
PLNLGYRPNERVMYKIKHGRTADCVVAGYRTHRGGTGVGSLLLGLYDDAGTLQHVGVCAA
FTARRRTELIAELEPLRLESVADHPWAAWGEAAAHEEARLPGAPSRWSGTKDLSWVPLRP
ERVCEVGYDHMEGTRFRHTTQFKRWRPDRTPESCTYAQLAEPVRYDLGAVLGESG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccccctgtgaagccgatgctcgccaagtccgtggcacggatt
ccgccggggatgcagtacgaggcgaagtgggacggcttccgggccctggtcttccgggac
gggccggagctggagctgggcagccgcaccggcaagacgctcacccggtacttcccggag
ctggtggcggcgctgctggagcggctgcccgagcggtgcgtggtggacggggagatcgtg
atggcgcgcgacgggcggctcgacttcgagctgctctccgagcgcatccacccggccgcc
tcccgggtgcggatgctggcggagaggaacccggcctccttcgtcgccttcgacctgctg
gccctcggcgacgaggacctgaccacccgccccctcaccgcacggcgggcgctgctggag
gaggagctgggcgaggccgctccgccgctccacgtggctccggccacccgcgatcccgag
ctggcggaacgatggttcgaccggttcgagggggcggggctggacggtgtggtggccaag
ccgctgaacctcggctaccggccgaacgaacgcgtcatgtacaagatcaagcacgggcgc
accgccgactgcgtggtggccggctaccgcacccaccggggcggcaccggcgtcggctcc
ctgctgctgggcctctacgacgacgcgggcaccctccagcacgtcggcgtctgcgccgcc
ttcaccgcccgccggcgcaccgagctgatcgccgaactggagccgctgcgactggagtcg
gtggccgaccacccgtgggcggcgtggggcgaggcggccgcccacgaggaggcccggctg
cccggcgcgccgagccgctggtcgggcacgaaggacctgtcgtgggtaccgctgcgcccg
gaacgcgtctgcgaggtcgggtacgaccacatggagggcacccgcttccgccacaccacc
cagttcaaacgctggcgcccggaccgtaccccggagagctgcacgtacgcgcagctcgcg
gagccggtccggtacgacctgggcgcggtactcggtgagtccggctga

DBGET integrated database retrieval system