KEGG   Streptomyces albidoflavus: XNR_0766Help
Entry
XNR_0766          CDS       T02545                                 

Definition
(GenBank) Beta-ketoadipyl CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00071  Fatty acid degradation
salb00280  Valine, leucine and isoleucine degradation
salb00281  Geraniol degradation
salb00362  Benzoate degradation
salb00592  alpha-Linolenic acid metabolism
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01120  Microbial metabolism in diverse environments
salb01130  Biosynthesis of antibiotics
salb01212  Fatty acid metabolism
Module
salb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XNR_0766
   00592 alpha-Linolenic acid metabolism
    XNR_0766
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XNR_0766
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    XNR_0766
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XNR_0766
   00642 Ethylbenzene degradation
    XNR_0766
Enzymes [BR:salb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     XNR_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGI87165
UniProt: D6AWF4
LinkDB All DBs
Position
897462..898682
Genome map
AA seq 406 aa AA seqDB search
MPRTIRDVVFVDGVRTPFGKAGPKGIYHETRADDLIVKAIRELLRRNPDLDPKKIDEVAI
AATTQIGDQGLTLGRTAGILAGLPQSVPGYSVDRMCAGAMTAVTTTAGSIAFGAYDVVVA
GGVEHMGRHPMGEGVDPNPRFVSEKLVDESALFMGMTAENLHDRYPTITKQRADAYAVRS
QEKAAKAYANGKIQQDLVPVSVRRTNAEAGETGWGLATADEPMRPGTTLESLAGLKTPFR
THGRVTAGNAAGLNDGATASLLAAEDVANELGLPVKMRLVSYSFAGVEPEVMGYGPIPAT
EKALKQAGLTIDDIGLFEINEAFAVQVLAFLEHYGIADDDARVNQYGGAIAYGHPLASSG
VRLMTQLARQFEEQPEVRYGLTTMCVGFGMGATVIWENPHFTGGNK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgcctcgtaccatccgggacgtcgtcttcgtcgacggcgtccgcaccccgttcggcaag
gcgggccccaagggcatctaccacgagacccgtgccgacgatctgatcgtgaaggcgatc
cgggagctgctgcgccgcaacccggacctggaccccaagaagatcgacgaggtggccatc
gccgccaccacgcagatcggcgaccagggcctcacgctgggccgcacggcgggcatcctc
gccgggctgccgcagtcggtaccgggctactccgtcgaccggatgtgcgccggtgccatg
acggccgtcaccacgacggccggctccatcgccttcggtgcctacgacgtggtcgtggcc
ggcggtgtcgagcacatgggccgccacccgatgggtgagggcgtcgaccccaacccgcgg
ttcgtctccgagaagctcgtcgacgagtcggccctgttcatgggcatgaccgcggagaac
ctccacgaccgctaccccaccatcaccaagcagcgcgccgacgcgtacgcggtccgctcg
caggagaaggccgccaaggcgtacgccaacggcaagatccagcaggacctggtgccggtg
tcggtccgccgcaccaacgccgaggccggcgagaccggctggggcctggccaccgccgac
gagccgatgcgcccgggcaccaccctggagtcgctggccgggctgaagaccccgttccgt
acccacggccgggtcaccgcgggcaacgccgccggtctcaacgacggtgccaccgcctcg
ctgctcgccgccgaggacgtggcgaacgagctgggcctgcccgtcaagatgcgtctcgtc
tcgtactccttcgcgggtgtcgagccggaggtcatgggctacggcccgatcccggccacc
gagaaggcgctgaagcaggccgggctgaccatcgacgacatcggtctcttcgagatcaac
gaggcgttcgccgtgcaggtgctcgccttcctggagcactacggcatcgccgacgacgac
gcccgcgtcaaccagtacggcggcgccatcgcctacggccacccgctggcctcctcgggc
gtccgcctgatgacccagctggcccggcagttcgaggagcagccggaggtccgctacggc
ctgaccaccatgtgcgtcggcttcggcatgggcgccacggtcatctgggagaacccgcac
ttcaccggaggcaacaagtga

DBGET integrated database retrieval system