KEGG   Streptomyces albidoflavus: XNR_1247Help
Entry
XNR_1247          CDS       T02545                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00473  D-Alanine metabolism
salb00550  Peptidoglycan biosynthesis
salb01100  Metabolic pathways
salb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    XNR_1247
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XNR_1247
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    XNR_1247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:salb01011]
    XNR_1247
Enzymes [BR:salb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     XNR_1247
Peptidoglycan biosynthesis and degradation proteins [BR:salb01011]
 Precursor biosynthesis
  Amino acid ligase
   XNR_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AGI87641
UniProt: D6B8Y7
LinkDB All DBs
Position
complement(1499612..1500784)
Genome map
AA seq 390 aa AA seqDB search
MSSENSPQNPALPEPGTEPRKPRVAVVFGGRSSEHGISVVTGGAVLGSIDRSRYDVLPIG
ITTEGGWVLTADEPARMAITERTVPDVDALAEPGEGTVVLPVAPGNREVLYSEPGSVPKA
LGDVDVVFPVLHGPYGEDGTFQGLLELAGIPYVGSGVLASAVGQDKEYMKRVFTSFGLPV
GPYLVIRPREWDADEAAARARVIDFAGEHGWPLFVKPARGGSSVGITKVDGPEGLDAALA
EARRHDPKVLVESLLRGREIECGVLEFEDGPRASVPAEIPPVQAHDFYDFEAKYIDSAPG
LVPAPLTEEQTAEVQRLAVEAFEAASCEGLVRADFFLTEDGGFVINEINTMPGFTPISMY
PRMWQESGVDYPALVDQLVQAALRRSTGLR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgagaactccccccagaacccggccctccccgagcccggaaccgaaccccgc
aagccgcgcgtcgccgtcgtcttcggcgggcgcagctccgagcacggcatctccgtggtc
accggcggcgccgtcctgggctccatcgaccgctcccggtacgacgtcctgcccatcggc
atcaccaccgagggcggctgggtgctcaccgccgacgagcccgcgcggatggcgatcacc
gagcgcaccgtccccgacgtcgacgcgctcgccgagcccggcgagggcaccgtcgtcctc
cccgtcgcccccggcaaccgcgaggtcctctacagcgagcccggctcggtgccgaaggcc
ctcggcgacgtcgacgtggtcttccccgtcctgcacggcccctacggcgaggacggcacc
ttccagggtctcctggaactggccggcatcccgtacgtcggctcgggtgtcctcgcctcc
gccgtcggccaggacaaggagtacatgaagcgggtcttcacctccttcgggctgccggtc
ggcccgtacctggtgatccgcccccgcgagtgggacgccgacgaggccgccgcccgcgcc
cgtgtcatcgacttcgccggtgagcacggctggccgctcttcgtgaagcccgcccgcggc
ggctcctccgtcggcatcaccaaggtcgacggccccgaggggctcgacgcggccctcgcc
gaggcccgccgccacgacccgaaggtcctcgtcgagtcgctgctgcgcggccgcgagatc
gagtgcggcgtcctggagttcgaggacgggccgcgcgccagcgtccccgccgagatcccg
ccggtccaggcccacgacttctacgacttcgaggccaagtacatcgactcggcgcccggc
ctggtacccgccccgctcaccgaggagcagacggcggaggtgcagcgcctcgccgtcgag
gccttcgaggccgcctcctgcgaagggctggtgcgcgccgacttcttcctcaccgaggac
ggcggcttcgtcatcaacgagatcaacaccatgcccggcttcacgccgatctccatgtac
ccgcgcatgtggcaggagtccggcgtcgactacccggccctggtcgaccagctggtgcag
gcggcgctgcgccggtccaccgggctgcgctga

DBGET integrated database retrieval system