KEGG   Streptomyces albidoflavus: XNR_1493Help
Entry
XNR_1493          CDS       T02545                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
salb  Streptomyces albidoflavus
Pathway
salb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:salb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    XNR_1493
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:salb03400]
    XNR_1493
Enzymes [BR:salb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XNR_1493
DNA repair and recombination proteins [BR:salb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     XNR_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGI87881
UniProt: D6B6S0
LinkDB All DBs
Position
1775711..1776616
Genome map
AA seq 301 aa AA seqDB search
MTPITHVEGRRLALSNLDKILYPATGFTKGEVLHYYASVAPVLLPHLRDRPLSFLRYPDG
AGGETFFAKNVPPGTPDWVRVATVPRSARDTTSARQVVVDDLPSLMWAANLVTEFHTPQW
RAEAPAVADRLVLDLDPGEPAGIAECCEVALMLRERLAADGLTAFAKTSGSKGLHLLAPL
TGAPSREVTAYAKELAVAAGQAAPELVVHRMAKRLRGGKVFVDFSQNSASKTTATPYTLR
ARPHPTVSAPLTWEEVATRGEDDRLPGLRIEADEAAARVERYGDLLAPLATGEAAAPLPG
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccatcacccatgtggaggggcggcggctcgcgctcagcaacctcgacaagatc
ctctatccggccaccggcttcaccaagggtgaggtgctgcactactacgcctccgtggcc
ccggtcctcctgccgcacctgcgggaccggccgctctccttcctgcgctatccggacggc
gccgggggcgagaccttcttcgccaagaacgtgccgcccggtacacccgactgggtgcgg
gtggcgacggtgccccgctccgcccgggacaccacgagcgcccggcaggtggtcgtggac
gacctgccgtccctgatgtgggcggccaacctggtgaccgagttccacacgccgcagtgg
cgggccgaggccccggccgtcgccgaccggctcgtcctggacctcgaccccggcgagccg
gccgggatcgccgagtgctgcgaggtggcgctgatgctgcgggagcggctggccgccgac
gggctgaccgccttcgccaagacctccggctcgaaggggctccacctgctggccccgctg
accggcgccccctcgcgcgaggtgacggcgtacgcgaaggagctggcggtcgccgccggg
caggcggcgccggagctggtggtccaccggatggcgaagcggctgcgcggcggcaaggtc
ttcgtcgacttcagccagaactccgcctcgaagaccaccgccaccccctacaccctgcgc
gcccgcccgcaccccaccgtctcggcccccctgacctgggaggaggtcgccacccggggc
gaggacgaccgcctgcccggcctgcggatcgaggcggacgaggcggcggcgcgggtggag
cggtacggggacctgctggcaccgctggccaccggggaggcggcggcaccgctgccgggg
agctga

DBGET integrated database retrieval system