KEGG   Streptomyces albidoflavus: XNR_1545Help
Entry
XNR_1545          CDS       T02545                                 

Definition
(GenBank) Nickel-dependent superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
salb  Streptomyces albidoflavus
Brite
KEGG Orthology (KO) [BR:salb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XNR_1545
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XNR_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AGI87933
UniProt: A0A2A2UJ05
LinkDB All DBs
Position
1839012..1839407
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQDKMQANDDPQFQTRAIVIKEQ
RAELAKHHVSVLWSDYFKPPHFESYPQLHQLVNDTLKALSAAKGSSDPATGQKALDLIAE
IDRIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggagtccgtcaaggccgtccaggac
aagatgcaggccaacgacgacccgcagttccagacgcgcgccatcgtcatcaaggagcag
cgcgccgagctggccaagcaccacgtctcggtgctgtggagcgactacttcaagcccccg
cacttcgagagctacccccagctccaccagctggtcaacgacaccctgaaggccctctcg
gccgccaagggctcctcggacccggccaccggccagaaggccctggacctcatcgccgag
atcgaccgcatcttctgggagaccaagaaggcgtga

DBGET integrated database retrieval system