KEGG   Streptomyces albidoflavus: XNR_2069Help
Entry
XNR_2069          CDS       T02545                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00620  Pyruvate metabolism
salb00680  Methane metabolism
salb01100  Metabolic pathways
salb01120  Microbial metabolism in diverse environments
salb01200  Carbon metabolism
Module
salb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XNR_2069
  09102 Energy metabolism
   00680 Methane metabolism
    XNR_2069
Enzymes [BR:salb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XNR_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGI88445
UniProt: D6B2N8
LinkDB All DBs
Position
complement(2433924..2436710)
Genome map
AA seq 928 aa AA seqDB search
MSSADAQATTTSATGRPGPTETPEPARTTSPELRADIRRLGDLLGEALVRQEGHELLDLV
ERVRALTRTDGEAAAELLGGLELEIAAKLVRAFSTYFHLANVTEQVHRGRELRARRAEEG
GLLARTADRLKDADPEHLRATVQNLNVRPVFTAHPTEAARRSVLGKLRRIAELLETPVIE
ADRRRHDTRLAENIDLVWQTDELRVVRPEPADEARNAVYYLDELHAGAVGDVLEDLTAEL
ARVGFELPENSRPLTFGTWIGGDRDGNPNVTPEVTWDVLILQHEHGINDALEVVDELRGF
LSNSIRYTGATEELLASLQADLDHLPEISPRYKRLNAEEPYRLKATCVRQKLENTKERLA
QGTAHQPGRDYLGTAELLTDLTLIQDSLREHRGGLFADGRMNRTIRTLAAFGLQLATMDV
REHADAHHHALGQLFDRLGEESWRYADMPRDYRTRLLAKELRSRRPLAPSPAPLDAAGEK
TLNVFHTVRRALAVFGPEVVESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVP
LLETTDELRAADVILDEMLADPSYRLLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRA
QRRLRDVAHRYGVRLRLFHGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDK
YLVPSLARENLELTVAATLQASALHTAPRQSVEALARWDAAMDTVSEAAHTAYRKLVEDP
DLPSYFLASTPVDQLAELHLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVG
SGLKALREAGLDGVLSEMYEHWHFFRNFVSNVEMTLAKTDLRIARHYVDTLVPDELRHVF
DLIEAEHALTVAEILRVTGGEELLDSNPVLQQTFAIRDAYLDPISYLQVSLLARQRAAAE
RGEDPDPLLSRALLLTVNGVAAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgcccaggccaccacgaccagcgccaccggccgccctgggcccacc
gagacccctgaacccgcccgcaccaccagccccgaactccgcgccgacatccgccggctg
ggtgatctgctgggcgaggccctggtccgccaggaggggcacgaactcctcgacctcgtc
gagcgcgtccgcgcgctgacgcgtacggacggggaagccgccgccgaactcctcggcggc
ctcgaactggagatcgcggccaagctggtccgcgccttctccacctacttccacctcgcc
aacgtcaccgagcaggtccaccggggccgcgagctgcgcgcccgccgcgccgaggagggc
gggctgctggcccgcaccgccgaccggctcaaggacgccgaccccgagcacctgcgggcc
accgtccagaacctcaacgtgcggccggtcttcaccgcccaccccaccgaggccgcccgc
cgctcggtcctcggcaagctccgccgcatcgccgagctgctggagaccccggtcatcgag
gccgaccggcgccgccacgacacccggctcgccgagaacatcgacctcgtctggcagacc
gacgaactccgcgtggtccgccccgaaccggccgacgaggcccgcaacgccgtctactac
ctggacgagctgcacgccggcgccgtcggcgacgtcctggaggacctcaccgccgagctg
gcccgggtcggcttcgagctgcccgagaactcccgcccgctgaccttcggcacctggatc
ggcggcgaccgcgacggcaacccgaacgtcacccccgaggtcacctgggacgtgctgatc
ctccagcacgagcacggcatcaacgacgccctcgaagtcgtcgacgagctgcgcggattc
ctctccaactccatccgctacaccggcgccaccgaggaactcctcgcctccctccaggcc
gacctcgaccacctccccgagatcagcccccgctacaagcggctcaacgccgaggagccc
taccggctcaaggccacctgcgtccgccagaagctggagaacaccaaggagcggctggcc
cagggcaccgcccaccagcccggccgcgactacctcggcaccgccgaactcctcaccgac
ctcaccctcatccaggactcgctgcgcgagcaccgcggcggcctcttcgccgacggccgg
atgaaccgcaccatccgcaccctggccgccttcggcctccagctcgccaccatggacgtc
cgcgagcacgccgacgcccaccaccacgccctcggccagctcttcgaccggctcggcgag
gagtcctggcggtacgcggacatgccgcgcgactaccgcacccggctgctggccaaggaa
ctccgctcgcgccgcccgctcgccccgagcccggccccgctcgacgccgccggcgagaag
acgctgaacgtcttccacacggtcaggcgggcgctggccgtcttcgggcccgaggtcgtc
gagtcgtacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccgccgtcctc
gcccgcgaggccgggctgatcgacctgcacgccggctgggccaagatcggcatcgtgccg
ctcctggagaccaccgacgagctgcgcgccgccgacgtcatcctcgacgagatgctcgcc
gacccctcctaccgcctgctcgtctcgctccgcggcgacgtccaggaggtcatgctcggc
tactccgactcctcgaagttcggcggcatcaccacctcccagtgggagatccaccgcgcc
cagcgccggctgcgcgacgtcgcccaccggtacggcgtacggctgcggctcttccacggc
cgcggcggcaccgtcggccgtggcggcggcccctcgcacgacgcgatcctcgcccagccc
tggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctccgacaag
tacctcgttccctccctggccagggagaacctggagctgaccgtcgcggccaccctccag
gcgtccgccctgcacaccgcgccccgccagtcggtcgaggcgctggcccgctgggacgcc
gccatggacacggtgagcgaggcggcccacaccgcctaccgcaagctcgtcgaggacccg
gacctgccctcgtacttcctcgcgtcgacgcccgtcgaccagctcgccgagctgcacctg
ggctcgcgtccctcgcgccgccccggctcgggcgtctcgctcgacgggctgcgcgccatc
ccgtgggtcttcggctggacccagtcgcggcagatcgtgcccggctggttcggcgtcggc
tccggcctgaaggcgctgcgcgaggccgggctggacggcgtgctcagcgagatgtacgag
cactggcacttcttccgcaacttcgtctccaacgtcgagatgacgctggccaagaccgac
ctgcggatcgcccgccactacgtcgacaccctcgtccccgacgagctgcgccatgtcttc
gacctcatcgaggccgagcacgcgctcaccgtcgccgagatcctccgcgtcaccggcggc
gaggaactgctcgactccaaccccgtcctccagcagaccttcgccatccgcgacgcctac
ctcgaccccatctcctacctccaggtctccctcctcgcccgccagcgcgccgccgccgaa
cgcggcgaggaccccgacccgctcctctcccgcgccctcctcctcacggtcaacggcgtg
gcggcgggcctccgcaacaccggctga

DBGET integrated database retrieval system