KEGG   Streptomyces albidoflavus: XNR_3809Help
Entry
XNR_3809          CDS       T02545                                 

Definition
(GenBank) Glycerol phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00564  Glycerophospholipid metabolism
salb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XNR_3809
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     XNR_3809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AGI90144
UniProt: D6B4A6
LinkDB All DBs
Position
4328437..4330143
Genome map
AA seq 568 aa AA seqDB search
MRTGTLGPDERAEALAAMAERELDILVVGGGVVGAGTALDAVTRGLATGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHAGWERLY
AGAGVALYDGMAMARGHGRGLPTHRHLSRRHALRVAPCLRKDALVGALQYYDAQMDDARF
VLDLIRTASSYGAKVANGARVTGFIREGERVVGAMVTDVEHGGEYEVRAKQVVNATGVWT
DDTQAMVGERGQFHVRASKGVHLVVPKDRINSSTGLILRTEKSVLFVIPWGRHWIVGTTD
TEWDLDKAHPAASSADIDYVLEHVNSVLAVPLSRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRIMAKDAVDEAVRGLNQRVADCVTEEVPLLGAEGYQAL
WNARARTAARTGLHVVRIEHLLNRYGTLTDELLQLIAEDPSLGEPLRYADDYLRAEIVYA
ATHESAHHLDDILTRRTRISIETFDRGTRSACECAELVAPVLGWDQERIDNEVAHYEMRV
EAERESQRQPDDLTADAARLGAPDVVQG
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacaggcacactgggaccggacgagcgggccgaggcgctcgccgcgatggccgaa
cgggaactggacatcctcgtggtcggcggcggggtggtcggcgcgggcacggcgctggac
gccgtcacccggggcctggccaccggcctcgtcgaggcccgcgactgggcgtccggcacc
tccagccgctccagcaagctcatccacggcggcctgcgctacctggagatgctcgacttc
gccctggtcagggaggcgctgaaggaacgcggcctgctcctggagcggctcgccccgcac
ctggtcaagccggtgcccttcctctacccgctccagcacgccggctgggagcgcctctac
gccggagccggcgtcgccctctacgacggcatggcgatggcccgcggccacgggcggggc
ctgcccacccaccgccacctcagccgccggcacgccctgcgcgtcgccccctgcctgcgc
aaggacgccctggtcggcgccctccagtactacgatgcccagatggacgacgcccgcttc
gtcctcgacctgatccgcaccgcctcctcgtacggcgccaaggtcgccaacggggcgcgc
gtcaccgggttcatccgcgagggtgaacgcgtggtcggcgccatggtcaccgacgtcgag
cacggcggcgagtacgaggtccgcgccaagcaggtcgtcaacgccaccggcgtctggacc
gacgacacccaggccatggtcggcgagcgcggccagttccacgtccgcgcctccaagggc
gtccacctggtcgtccccaaggaccgcatcaactcctccaccgggctcatcctgcgcacc
gagaagtcggtcctcttcgtcatcccctggggccggcactggatcgtcggcaccaccgac
accgagtgggacctggacaaggcccacccggccgcctccagcgccgacatcgactacgtc
ctcgaacacgtcaactccgtccttgccgtcccgctctcccgcgacgacgtcgagggcgtc
tacgccgggctccgcccgctgctcgccggcgagtccgacgccaccagcaagctctcccgc
gagcacaccgtggcccacccggtgcccgggctcgtcgtggtggccggcggcaagtacacg
acgtaccggatcatggccaaggacgccgtggacgaggcggtgcgcgggctcaaccagcgc
gtcgccgactgcgtcaccgaggaggtcccgctgctcggcgccgaggggtaccaggccctg
tggaacgcccgcgcccgcaccgccgcccgcaccgggctgcacgtggtccgcatcgagcac
ctgctcaaccgctacggcaccctcaccgacgaactcctccagctcattgcggaggacccc
tccctcggcgaaccgctgcgctacgccgacgactacctccgcgccgagatcgtctacgcc
gccacccacgagagcgcccaccacctcgacgacatcctcacccgccgcacccgcatctcc
atcgagaccttcgaccggggaacccgcagcgcctgcgagtgcgccgaactggtcgccccc
gtcctcggctgggaccaggagcggatcgacaacgaggtcgcgcactacgagatgcgcgtc
gaggccgaacgcgagtcgcaacgccagccggacgacctgacggcggacgcggcgcggctg
ggggcgccggatgtggtgcagggatag

DBGET integrated database retrieval system