KEGG   Streptomyces albidoflavus: XNR_3933Help
Entry
XNR_3933          CDS       T02545                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00020  Citrate cycle (TCA cycle)
salb00190  Oxidative phosphorylation
salb00650  Butanoate metabolism
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01120  Microbial metabolism in diverse environments
salb01130  Biosynthesis of antibiotics
salb01200  Carbon metabolism
Module
salb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
salb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XNR_3933
   00650 Butanoate metabolism
    XNR_3933
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XNR_3933
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XNR_3933
    1.3.5.4  fumarate reductase (quinol)
     XNR_3933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer4 Fer4_4 Fer4_18 Fer4_6 Fer4_2 Fer4_15 Fer4_3 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AGI90268
UniProt: D6B3C2
LinkDB All DBs
Position
complement(4471221..4471979)
Genome map
AA seq 252 aa AA seqDB search
MATPVLDKPAQDATASHLITITLRVRRFLPEVSDEVTWEDFALEIDPKERVLDALHKVKW
EMDGTLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDINPEKPITVEPIKGLAVLKDLV
VDMEPFFQAYRDVMPFLVTKGNEPTRERLQSAEDRERFDDTTKCILCAACTSSCPVFWND
GQYFGPAAIVNAHRFIFDSRDEAGEQRLEILNDKDGVWRCRTTFNCTDACPRGIEVTKAI
AEVKKALITRRY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctacccccgtactcgacaagccggcccaggacgccaccgcgtcccacctgatcacg
atcacgctgcgcgtgcgccggttcctgcccgaggtctccgacgaggtcacctgggaggac
ttcgcgctggagatcgaccccaaggagcgggtcctcgacgcgctccacaaggtcaagtgg
gagatggacgggacgctgacgttccgccgttcctgcgcccacggcatctgcggctccgac
gccatgcgcatcaacggccgcaaccgcctcgcgtgcaagacgctgatcaaggacatcaac
ccggagaagcccatcacggtcgagcccatcaagggtctcgcggtcctcaaggacctcgtg
gtggacatggagccgttcttccaggcgtaccgggacgtcatgccgttcctggtcaccaag
gggaacgagccgacccgcgagcgcctgcagtcggccgaggaccgcgaacggttcgacgac
accaccaagtgcatcctgtgcgccgcgtgcacctcgtcgtgcccggtcttctggaacgac
ggccagtacttcggtccggccgccatcgtcaacgcccaccgcttcatcttcgactcgcgt
gacgaggccggcgagcagcggctggagatcctcaacgacaaggacggcgtgtggcgctgc
cgcaccacgttcaactgcacggacgcctgcccgcgcggtatcgaggtcaccaaggcgatc
gccgaggtcaagaaggcgctcatcacgcgccgctactga

DBGET integrated database retrieval system