KEGG   Streptomyces albidoflavus: XNR_3934Help
Entry
XNR_3934          CDS       T02545                                 

Definition
(GenBank) Succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00020  Citrate cycle (TCA cycle)
salb00190  Oxidative phosphorylation
salb00650  Butanoate metabolism
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01120  Microbial metabolism in diverse environments
salb01130  Biosynthesis of antibiotics
salb01200  Carbon metabolism
Module
salb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
salb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XNR_3934
   00650 Butanoate metabolism
    XNR_3934
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XNR_3934
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XNR_3934
    1.3.5.4  fumarate reductase (quinol)
     XNR_3934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like DAO Thi4 Pyr_redox_2 Pyr_redox_3 DUF1978 GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGI90269
UniProt: D6B3C1
LinkDB All DBs
Position
complement(4471979..4473733)
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIEATKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEDD
NWEWHTFDTVKGGDYLVDQDAAEILAKEAIDAVLDLEKMGLPFNRTPEGRIDQRRFGGHT
RSHGEAPVRRACYAADRTGHMILQTLYQNCVKEGVEFFNEFYVLDQLITEVDGVKKSAGV
VAYELATGEIHVFQAKSVVYASGGTGKFFKVTSNAHTLTGDGQAACFRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVFLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVQGEVLADNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYSHG
NDYVELPEDPAAQVIEMVERLRDSNGTERVTELRTELQETMDANVMVFRTEQTIKTAVDK
IAELRARYKNVSVQDKGRRFNTDLLEAIELGNLLDLAEVMAQSALARKESRGGHYREDFP
NRDDVNFMRHTMAYREVGDDGQESIRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcgtcggcgccggcggcgccggcatgcgcgcc
gccatcgaggcgacgaagcgcagccgcaccgccgtgctgaccaagctctacccgacccgc
tcccacaccggcgcggcccagggcggcatggccgccgccctcgccaacgtcgaggacgac
aactgggagtggcacaccttcgacacggtcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgacgcggtcctggacctcgagaagatgggc
ctgccgttcaaccggacgcccgagggccgcatcgaccagcgccgcttcggcggtcacacc
cgcagccacggcgaggccccggtccgccgcgcgtgctacgcggccgaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtcctggaccagctcatcaccgaggtcgacggggtcaagaagtccgccggcgtc
gtcgcctacgagctggccaccggcgagatccacgtcttccaggccaagtcggtcgtctac
gcctccggcggcaccggcaagttcttcaaggtgacgtcgaacgcgcacacgctgaccggt
gacggccaggccgcctgcttccgccggggcctgccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcgcatgggcatcctcctgaccgagggcgcccgcggtgag
ggcggcatcctccgcaacaaggacggcgagcgcttcatggagaagtacgcgcccgtcatg
aaggacctcgcctcgcgtgacgtcgtctcgcgctccatctacacggagatccgcgagggc
cgcggctgcggtcccgagggcgaccacgtcttcctcgacctcacccacctgccgccggag
cagctggacgcgaagctcccggacatcaccgagttcgcgcgcacctacctcggcatcgag
ccctacacggacccgatcccgatccagccgaccgcgcactacgccatgggcggcatcccc
accaacgtccagggtgaggtcctcgcggacaacaccacggtcgtcccgggcctgtacgcc
gccggtgaggtcgcctgcgtctcggtgcacggcgccaaccgcctcggcaccaactcgctg
ctcgacatcaacgtcttcgggcgccgggcgggcatcgccgccgccgagtactcccacggc
aacgactacgtggagctgccggaggacccggccgcccaggtgatcgagatggtcgagcgg
ctgcgggactccaacggcacggagcgcgtcaccgagctgcgcaccgagctgcaggagacg
atggacgccaacgtcatggtcttccgcaccgagcagaccatcaagacggccgtcgacaag
atcgccgagctgcgcgcccggtacaagaacgtctccgtccaggacaagggccgccgcttc
aacacggacctgctggaggccatcgagctgggcaacctgctcgacctggccgaggtcatg
gcgcagtcggccctcgcccgcaaggagtcgcgcggcggtcactaccgcgaggacttcccc
aaccgcgacgacgtcaacttcatgcgccacaccatggcgtaccgcgaggtcggcgacgac
ggccaggagtcgatccggctcgactacaagccggtcgtccagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system