KEGG   Streptomyces albus J1074: XNR_4488Help
Entry
XNR_4488          CDS       T02545                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
salb  Streptomyces albus J1074
Pathway
salb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:salb00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    XNR_4488
Enzymes [BR:salb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XNR_4488
DNA repair and recombination proteins [BR:salb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     XNR_4488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGI90811
LinkDB All DBs
Position
5105607..5106548
Genome map
AA seq 313 aa AA seqDB search
MSAVGAGDEERVRAGRRTLTVHRPDKVFYPADGLTKGEVVGYYRDIAPHMVPHLRDRPLM
LERDPEGVGEQPHFMQKNAGAHYPEWVRRAPMPKEDGGTVDHPVCDDAATLVYLADQAVL
TFHRWLSTVGNPRHPDLLVLDLDPPGDDFAAVREAALRLRELLAEVELDPLLMTTGSRGL
HLVVRLDGRAGHDTVRAFAQDAAELLAARHPDRLTTAVRKDRRGDRLFLDSGRNAYAQTA
VAPWSLRSRPGAPVAAPLTWEQLDDPELDARTFSLRDPDGVQAQAASRPWARPPRPRGIA
AAARRLEKLRRSG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggtgggcgccggggacgaggaacgcgtccgggccgggcggcgcaccctcacc
gtccaccggcccgacaaggtgttctatccggccgacggcctcaccaagggcgaggtcgtc
ggctactaccgggacatcgccccgcacatggtgccccacctgcgcgaccgcccgctgatg
ctggagcgcgaccccgaaggcgtcggtgagcagccgcacttcatgcagaagaacgccggc
gcccactacccggaatgggtacgccgggcgccgatgcccaaggaggacggcggcaccgtc
gaccacccggtctgcgacgacgccgccaccctcgtctacctcgccgaccaggccgtgctc
accttccaccgctggctctccaccgtcgggaacccccgccaccccgacctcctcgtcctc
gacctcgacccgccgggcgacgacttcgcggcggtccgcgaggccgccctgcgcttgcgg
gaactcctcgccgaggtggagctggacccgctgctgatgaccaccggctcgcgcgggctg
cacctcgtcgtccggctcgacggccgcgccggtcacgacaccgtccgcgccttcgcccag
gacgccgccgaactgctggccgcccgccaccccgaccggctcaccaccgccgtccgcaag
gaccgccggggcgaccgcctcttcctcgactccggccgcaacgcctacgcccagacggcc
gtggccccctggtcgctccgctcccgccccggcgcccccgtcgccgcgccgctcacctgg
gagcagctcgacgacccggaactcgacgcccgtaccttctcgctccgtgacccggacggc
gtacaggcgcaggccgcgtcccggccctgggcccggccgccgaggccgcgggggatcgcg
gccgccgcgcggcggctggagaagctgcgacggagtggctga

DBGET integrated database retrieval system