KEGG   Streptomyces albus J1074: XNR_4489Help
Entry
XNR_4489          CDS       T02545                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
salb  Streptomyces albus J1074
Pathway
salb00380  Tryptophan metabolism
salb00630  Glyoxylate and dicarboxylate metabolism
salb01110  Biosynthesis of secondary metabolites
salb01130  Biosynthesis of antibiotics
salb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XNR_4489
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    XNR_4489
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     XNR_4489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGI90812
UniProt: D6AZ66
LinkDB All DBs
Position
5106679..5108775
Genome map
AA seq 698 aa AA seqDB search
MAQNKSPDPKQRQRAEALAPDPCGGPLTTDQGVTVEHTDDSLRAGERGPTLLEDFHFREK
ITRFDHERIPERVVHARGAGAYGYFEPYASCAEFTRAAFLQDPAVRTPVFVRFSTVQGPR
GSADTVRDVRGFATKFYTSEGNYDLVGNNFPVFFIQDGIKFPDFVHAVKMEPHNEIPTGA
SAHDTLWDFVSLQPETLHTIMWLMSDRAIPRSYRMMQGFGVHTFRFVDAAGKGTFVKFHW
KPKLGVHSLVWDEAQEVMGRDPDFNRRDLWDTIEAGQYPEWELGVQLVPEADEHKFDFDL
LDATKIIPEEQVPVRPIGRMVLDRNPDNFFAETEQIAFCTANVVPGIDFTNDPLLQARNF
SYLDTQLIRLGGPNFAHIPVNRPVVDVRNNQRDGYHQEEIHRGTNYSPNSLGGGCPALGS
VDEGAYRHLAERVDGVKIRKRSPSFDDHYTQAALFWHSMAGWEKQHIVDAFRFELGKVGA
VPVRERTVEQLARVDHELATAVAEGIGVAAPARQETPSPQPSPALSFENNQGESTIATRQ
IALLVTDGVDAHQATVLRDTLRERGAVAEVLAPHDGTVRAADGSPLTVDRALPTVAAVLY
DAVVLTDGSEPGDGSDGDAARRFVRNAYRHGKPVAAYGSATALLTRLLPDGLRLSTPDGE
VTADRGVVSGGTADSPFTEELVKAVAAHRFRDRPAPRA
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaacaagtcccccgacccgaagcagcggcagcgcgcggaggcgctcgcgccc
gacccctgcggcggacccctcaccaccgaccagggcgtgaccgtcgagcacaccgacgac
tcgctgcgcgccggcgaacgcgggcccaccctgctggaggacttccacttccgggagaag
atcacccgcttcgaccacgagcgcatccccgagcgggtggtgcacgcccggggcgccggg
gcgtacggctacttcgagccctacgcctcctgcgcggagttcacccgggccgccttcctc
caggaccccgccgtgcgcaccccggtcttcgtccgcttctccaccgtgcaggggccgcgc
ggctccgccgacaccgtgcgcgacgtgcgcggcttcgcgacgaagttctacaccagcgag
ggcaattacgacctggtgggcaacaacttcccggtcttcttcatccaggacggcatcaag
ttcccggacttcgtgcacgcggtgaagatggagccgcacaacgagatccccaccggcgcc
tccgcccacgacaccctctgggacttcgtctcgctccagccggagacgctgcacaccatc
atgtggctgatgtccgaccgggccatcccgcgcagctaccgcatgatgcagggcttcggg
gtgcacaccttccgcttcgtcgacgccgcgggcaagggcaccttcgtcaagttccactgg
aagccgaagctcggcgtccactcgctcgtctgggacgaggcccaggaagtgatgggccgc
gaccccgacttcaaccggcgcgacctctgggacaccatcgaggccggccagtaccccgag
tgggaactgggtgtgcagctcgtgcccgaggcggacgagcacaagttcgacttcgacctc
ctcgacgccacgaagatcatcccggaggagcaggtccccgtacggcccatcggccgcatg
gtgctcgaccgcaacccggacaacttcttcgccgagaccgagcagatcgccttctgcacc
gccaacgtcgtgcccggcatcgacttcaccaacgacccgctgctccaggcccggaacttc
tcctacctggacacccagctcatccggctcggcggccccaacttcgcccacatcccggtc
aaccggccggtggtcgacgtccgcaacaaccagcgcgacggctaccaccaggaggagatc
caccggggcaccaactactcgcccaactcgctgggcggcggctgccccgcgctcggctcc
gtggacgagggcgcctaccgccacctcgccgaacgcgtcgacggcgtcaagatccgcaag
cgcagccccagcttcgacgaccactacacgcaggccgcgctcttctggcactccatggcc
ggctgggagaagcagcacatcgtcgacgccttccgcttcgaactcggcaaggtgggcgcc
gtgccggtccgtgagcgcaccgtcgagcagctcgcccgcgtcgaccacgagctggccacc
gccgtcgccgagggcatcggcgtcgccgcccccgcccgccaggagaccccgagcccgcag
ccgtccccggcgctgagcttcgagaacaaccagggcgagtccaccatcgccacccggcag
atcgccctgctcgttaccgacggcgtcgacgcccaccaggccaccgtcctccgcgacacc
ctgcgcgaacgcggcgccgtcgccgaggtgctggccccgcacgacggcaccgtacgcgcc
gccgacggctcccccctcaccgtcgaccgggccctgcccaccgtcgccgccgtcctgtac
gacgcggtggtgctcaccgacggcagcgagccgggcgacggctccgacggcgacgcggcc
cggcgcttcgtccgcaacgcctaccgccacggcaagcccgtcgccgcctacggctccgcc
accgcgctgctgacccggctgctccccgacgggctgcggctgagcacccccgacggtgag
gtcaccgccgaccgtggcgtggtcagcgggggcaccgccgactcgccgttcaccgaggag
ctggtgaaggccgtcgccgcccaccgcttccgcgaccgcccggcgccccgggcctga

DBGET integrated database retrieval system