KEGG   Streptomyces albidoflavus: XNR_5008Help
Entry
XNR_5008          CDS       T02545                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00061  Fatty acid biosynthesis
salb00780  Biotin metabolism
salb01100  Metabolic pathways
salb01130  Biosynthesis of antibiotics
salb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    XNR_5008
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    XNR_5008
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    XNR_5008
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:salb01004]
    XNR_5008
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     XNR_5008
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     XNR_5008
Lipid biosynthesis proteins [BR:salb01004]
 Fatty acid synthase
  Component type
   XNR_5008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AGI91329
UniProt: D6BBL6
LinkDB All DBs
Position
5690126..5690905
Genome map
AA seq 259 aa AA seqDB search
MSGLLAGKRIIVTGVITQASIAFHVARLAQDEGADVVLTGFGRLSLVERIAKRLPKPVPV
IELDVQNEEQLASLADKVAEHYGDDAGIDGVVHSIGFAPQDALGGNFLNTPWESVGTAVH
VSAYSLKSLTMAVLPLLEKRGGSVVGLTFDATLAWPKYDWMGVAKAALESTSRYLARDLG
PKNIRCNLVSAGPLGSMAAKSIPGFEDLATVWDERSPLAWELSDPEPAARGVVALLSDWF
PKTTGEIVHVDGGLHAIGA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagtggacttctcgcaggcaagcgcatcatcgtcaccggcgtcatcacccaggcgtcg
atcgccttccacgtcgcccgcctcgcccaggacgagggcgccgacgtcgtcctcaccggc
ttcggccgcctctccctggtggagcgcatcgccaagcgcctccccaagcccgtccccgtc
atcgagctggacgtgcagaacgaggagcagctcgcctccctcgccgacaaggtcgccgag
cactacggcgacgacgccgggatcgacggcgtcgtgcactccatcggcttcgccccgcag
gacgccctgggcggcaacttcctcaacacgccctgggagtcggtcggcaccgccgtccac
gtctcggcgtactccctgaagtcgctcaccatggcggtgctgccgctcctggagaagcgc
ggcggctcggtcgtcggcctcaccttcgacgccaccctcgcctggccgaagtacgactgg
atgggtgtcgccaaggccgccctggagtccaccagccgctacctcgcccgcgacctcggc
ccgaagaacatccgctgcaacctcgtctccgccggaccgctcggctccatggccgccaag
tccatccccggcttcgaggacctcgccaccgtctgggacgagcgctccccgctcgcctgg
gagctgagcgacccggagcccgccgcccgcggtgtcgtggcgctgctctccgactggttc
ccgaagaccaccggcgagatcgtccacgtcgacggcggcctccacgccatcggcgcctga

DBGET integrated database retrieval system