KEGG   Streptomyces albidoflavus: XNR_5857Help
Entry
XNR_5857          CDS       T02545                                 

Definition
(GenBank) FscB
  KO
K16393  candicidin polyketide synthase FscB
Organism
salb  Streptomyces albidoflavus
Pathway
salb01052  Type I polyketide structures
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    XNR_5857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N ADH_zinc_N_2 Epimerase ADH_zinc_N PKS_DE GDP_Man_Dehyd Polysacc_synt_2 Docking NmrA ADH_N 3Beta_HSD ACP_syn_III RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AGI92160
LinkDB All DBs
Position
6644982..6661604
Genome map
AA seq 5540 aa AA seqDB search
MSNEDRLRAYLKRAVTDLQEARQQLSDAENRDREPVAVVAMACRYPGGVRTPEDLWELAR
DGVDAISAFPANRGWDLDHLFHPDPAHHGTTYTREGGFLHDAGEFDPAFFGISPREALAM
DPQQRLLLETSWEALERAGILPDTLAGSTTGVFVGTGHGDYDGASRGRQEEVAGHLLTGN
TVAVASGRLSYTYGFEGPAVTVDTACSSSLVALHLAVRSLRQGECSLALAGGATVMSTPK
MFTEFSRQQGLAADGRCKPFAAGADGTAWSEGVGLILLERLSDAQRNGHEILAVIRGSAI
NQDGASNGLTAPNGPSQQRLIRQALIDAGLTSGEVDVVEAHGTGTTLGDPIEAQALLNTY
GQDRGDAHPLLLGSLKSNTGHTQAASGVAGVIKMVQAMRHGTLPKSLHVDAPTPHADWAT
GGVELLTESTTWPETGRPRRAAVSSFGVSGTNAHLILEQAPEDQAPRAEDPGTGPAGTTG
DGTWRSWMVSGKSRAAVGEQAARLAASVRASDASVLDVAHALVSSRVAMDRRAVVVGSDR
EELLAGLDALAAGEPSVRVVEGTAGEGAGDVAFVFPGQGSQWVGMAVELLGSSPVFAGRV
AECAAALEPFTEWSLLDVLNGVEGAASLERVDVVQPVLWAVMVSLAEVWRAQGVEPGAVI
GHSQGEIAAAVVAGGLSLEDGARVVALRSRALRALSGLGGMVSVARNVDEVRGLLAGWEG
RIGVAAVNGPSSVVVSGDAEALDEFVAACDASGVRARRVAVDYASHSAHVERIEEELAGL
LAPVAPRSCDVPFYSTVSGQVVDTAGLDAGYWYRNLRGTVEFEAGTRALLADGFRVFVEV
SAHPVVATGVQETIEDAGVQAGVVGTLRRDEGGLERFALSLGEAWALGAEVDWETHYAGT
RPRHVDLPTYPFRRDWYWLTPAESAAAAATGDPADGDFWSAVESGDLTRLSSVLEVTGDD
VEAFGTLLPALASWRRRRTLRSTLDTWRHRVTWTALTGADDAVPAGRWPALVPAGHADDP
WVHAVLAALTARGLRVERHDLTGDEDTAALTALLTGTGDTETDGAEGIAGVLSLLALDER
PHPDHPAVPRGLATAKELLHALSGTEASVWALTRGAVAVDSRDRLTSPVQAETWGFGRAV
ALELPDAWGGLADLPADPDARSLARLATLLGGPEDQIAVRSSGAYARRLARMPLPEPARA
TDADAELAVRAADDDGIAGWGDHDTVLITGGTGALGAHVARSLAASGARHLVLTSRRGPG
SPGAAELVAELEELGARVTVADCDVADRDQLARLLDSLPADLPLTGVVHAAGVLDDGVLD
ALTLDRFEAVLRPKTLGTAHLHELTRDHDVTLFVLFSSIVGVLGNAGQANYAAANAYLDA
VAEQRRAEGLPVTSVAWGPWADAGMATADVLADRMSHDGLAPMDPVTAVAALRAAVAEGI
PHATVLDVDWRAYGTAMTAARPSPLVGDLPEVRRALEAAAATAPDTHALRDRLRGLAPAE
QDRLLTDLVRAEVATALRHSSPEAVDVNRAFKDLGFDSLTAVEVRNRITAATDVKLPTTL
LFDHPNTTAVVAHLRTLLLGDERPAAAPVVVSAGVTDEPMAVVAMACRFPGGVTTPEELW
HLMAAEVDAVSTPPEDRGWDLDALYDPDPERHGTTYSREGGFIQDVAGFDPAFFGISPRE
ALAMDPQQRLLLETSWETFERAGIDPGTLRNSATGVFVGSITTDYQVRLGGAAAQEQLAG
HLMTGNASSIASGRLSYTYGFEGPAVTMDTGCSSSMVALHLALQSLRTGECTMALAGGVT
VMSTPEPYVEFSRQRGLAADGRCKAFAEGADGMGFAEGVGLVLLERLSDARRNGHPVLAV
VRGSALNQDGASNGLTAPNGPSQQRVIRQALANAGLAPGEVDVVEAHGTGTPLGDPIEAQ
AILATYGQDRDPARPLLLGSLKSNIGHTQAAAGVAGMMKMILAMRQGTLPKSLHISRPTS
VVDWSSGAVRLVTESTPWPETGRPRRAGVSSFGISGTNGHLILEEAPAPEPAEDEPADPF
TEPSADDSADTVRSWMVSGKSRAVVGEQAARLAASVRASDASVLDVAHALVSSRVAMDRR
AVVVGSDREELLAGLDALAAGEPSPRLVEGSVGDGSGKVAFVFPGQGSQWVGMAVELLGS
SPVFAGRVAECAAALEPFTEWSLLDVLNGVEGAASLERVDVVQPVLWAVMVSLAEVWRAQ
GVEPGAVIGHSQGEIAAAVVAGGLSLEDGARVVALRSRALRALSGLGGMVSVARNVDEVR
GLLAGWEGRIGVAAVNGPSSVVVSGDAEALDEFVAACDASGVRARRVAVDYASHSAHVER
IEEELAGLLAPVAPRSCDVPFYSTVSGQVVDTAGLDAGYWYRNLRGTVEFEAGTRALLAD
GFRVFVEVSAHPVVATGVQETIEDAGVQAGVVGTLRRDEGGLERFALSLGEAWALGAEVD
WETHYAGTRPRHVDLPTYAFQRQHYWPRFAELGGDVSSAGLDSPDHPLLGASVELAGGDG
LVATARWSLRTHPWLADHAVSGTVIVPGTALVESVIRAGDVLGCGRIEELALQAPVVLQE
RGEAQVQIGVGEPDASGRRPVTVHTRTTGPDGATEDLWTLRAQGTLTEPGAPAVDRPEEF
TSWPPPGATAVAAEGFYELLAGRGYEFGPVFQGVRATWSRGEDLYAEVVLPEQIRGDAGR
FGIHPALLDAALHAAHLAPGSAGRTVVPFTWSGVCLHAAGATALRVRVSPAGQDAISVQL
TDPTGAPVATIDALAVREIAPDTLDPSARAARDWLFRLDWTPVTPPAAVPAATGWAVLGT
PADPVTAPDGSGTTLPAFATPGALAEHTEATGHRPDAVLLFAGAAASGTAAAPDAEPGVP
DAVLDDVLATVQSWLADETTEGVPLVVVTRGAVPTGPADPAHDLPGAAVWGLVRSAQSQH
PGRLVLADLDIHDDSWLALPAALAAGEPQLALRQGAAYAPRLVRPRTSDALTVPEGTGNW
RLDIPEKGSVDRLDLVAAPGAAEEPAAGEVVIEVRAAGLNFRDVLNTLGMYPGPAVLLGA
EAAGVVTAVGEGVTGFAPGDRVMGLVSGGFAPRAVADARMLAPVPDGWTWAQAASVPVAF
LTAYYGLRDLAHLDAGESVLVHAAAGGVGMAAAQLARHWGAEVYGTAGDHKRTLLRADGW
DDAHLASSRTLAFEDRFRATSGGRGVDVVLNSLAGDYIDASLRLLAPGGRLVDMGKTDVR
DPGQVLRDHPAVALYQAYELREAGEDRIQEMFRDLSELFASGALRPLPTVTWDVRHAREA
FRHMAQAKHYGKIVLTLPRAWDPEGTVLVTGGAGVLGGILARHLVTRHGMRHLVLTGRRG
PDTPGAGELAAELRELGAEVTLAACDAADADALAAVLAAVPAEHPLTAVVHAAGVLDDGV
LESLTPDRLRTVLAPKADAARHLHRLTRDLDLADLVLFSAGAGVFGNAGQANYAAANTYL
DALAHRRRADGLPTTSLSWGLWADTSALTGQLDDTDLARVRRSGVLPLSAADGMVLFDAA
LTEQRPHLVPVRLETGQLRASGDEVPPLLRSLYRGPVRRTAEAGAAAGTDGLRARLAGRS
AEDRLSTLRDLVGAHAAAVLGHDDTEPFHAGRAFRDLGFDSLTAVELRNRLSAATGLRLP
ATLVFDHPTVAALAAHLDGELSDGTPAALPAAPAPVPAVPGDDDPFAIVGMACRLPGDIH
SPEDLWRLLADGADAVAPFPDDRGWDLARLYDSVPEGQGSSRTREGGFLHDAADFDADFF
GISPREALAMDPQQRLLLETAWETFERAGIDPRSVRGSRTGVFAGLSSSDYLKRVTHVPD
EIAGYVNNGNANSIVSGRVSYTLGLEGPAVTVDTACSSSLVALHMALQALRRGECTMALA
GGVTVMSSPEIIVDFSRQRGLAADGRCKPFAEAADGTGFSEGVGLILVERLSDARRNGHQ
VLAVVRGSAVNQDGASNGLSAPNGPAQQRVIRQALADAGVGAAEVDAVEAHGTGTRLGDP
IEAQALLATYGRDRDGGHPLFLGSVKSNLGHTQAAAGVAGVMKMVLALRHRLLPESLHID
APTPHVDWADSGVRLLTEATAWPEPSASRPRRAAVSSFGISGTNAHVILEEAPAAPGPDG
GEPEPTGADATETRPTPLPWVLSARSEAALRGQAKALLTHLDAHPGTDPADIAHTLVTRR
AQLEKRAVVVGSATGDFRAGLAALAEGSPAAHVVTGGRGAGRDRRTVLVFPGQGSQWAGM
GAELLDASPAFAGRVAACEEALAPYVDWSLTAVLRQEEGAPALDRVDVVQPVTWAVMVAL
AEVWRAHGLRPAAVLGHSQGEIAAAAVAGALSLADAARIVAVRSRAIARELSGHGGMVAV
TAPHDEVTALLADLPGVCVAAVNGPSSVVVSGDTGGLDTLLAACEEQGVRARRVPVDYAS
HSAHVDRLAESLPAALDGIEPRDGDIPFFSTVTADWHPGTGLGAAYWHRNLRGTVRLEES
LRALVEQGHDVFVECGPHPVLTVGIEDTVAALGADAVALGSLRRDDGGPARVLTALAAAH
VEGVPVDWRPAVSHGTAVDLPTYAFQRRRYWLDAGTPQGDPAGLDSVVRLADGGAVLSGS
LSLATQPWLDAHRTHGAAVVPTTALLDWAVRAGDETGLPVVAALDEHSPLVVPEEGHVEI
QLTVSAADTDSRPFSVHSRLHAADAGEPATPWTRNATGALTDRPTTTPQPSGTWPLADAV
AGDPAPARALAEDRGLDLAAPFDTVRSLWRAGTDVLAEVALPDTAHADAARFRLHPALLQ
TPLALAATTEEATAPVLPAAWRDVTVHATGATRLRVRLTPGDDATWSVEARDAAGDLVLT
GTAVTRPAGPDRLPATAGPDAPHRVAWLPWTDSTSSATPEPHGPWAVIGAPGRLTAALER
SGATVQLHADLAALTTALDNGEAAPPALVVAFHGHDSGEDPTRAAHTSASRALELSTAWL
REPRLAGARLLLVTEGAVATGPDDTVPGLADATAWGLLRSAQTEHPGRFLLADLDPALGD
TDEDSAADTLIAAAAAAARTGEHQFAVRAGTVTVPRLVPADHPEGAPAPAATAPWGEGTG
AGTVLITGGTGTLGALVARHLVTRHGVRHLLLTSRRGPGAPGAAALREELAALGAEAEIV
ACDVADREQLAGVLDAVPAEHPLTAVVHTAGVLDDGTLDGLTPDRVAHVLRPKADAAWHL
HELTRDTKLTAFVMFSSYAGVAGGPGQANYAAANAFLDALAQHRRASGLPAHSLAWGLWE
DRSDLTGALDTTGLARLERSGIRPLTAGQGLALLDASTALDTAHLVPVRLDTRTLRADEA
PPLLRALARPAVRRAADSGPDAATGAPADLRERLAGLSGPQQRALLHRTVLGHLAAVLGH
ASAASLDADRGFLDLGMSSLTAVELRNRLNADIGLSLPTTLIFDHPDPAALVRHLQTELG
TGAGEPDQAVFAELAALETAVGGAALDDQDRARLAQRLKALGWKLDATSQDADEPDDDSD
LDTTTDDEMFDLIDNELGLA
NT seq 16623 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaggacaggctccgcgcatatctcaagcgggccgtcaccgatctccaggag
gcccggcagcagctcagcgacgccgagaaccgcgaccgcgagcccgtcgccgtcgtcgcc
atggcctgccgctaccccggcggcgtgcgcacccccgaggacctgtgggaactggcccgc
gacggagtggacgccatctccgcgttccccgcgaaccgcggctgggacctcgaccacctg
ttccacccggaccccgcccaccacggcaccacctacacgcgtgaaggcggattcctccac
gacgccggtgagttcgacccggcgttcttcgggatctcgccgcgcgaggccctggccatg
gacccgcagcagcggctcctgctggagacctcctgggaggcgctggagcgcgccggcatc
ctgcccgacaccctcgcgggcagcaccaccggtgtcttcgtcggcaccgggcacggcgac
tacgacggcgcctcgcgcggccgccaggaagaggtcgccgggcacctgctcaccggcaac
acggtcgccgtcgcctccggccgcctgtcgtacacgtacggcttcgaggggcccgccgtg
acggtggacaccgcctgctcctcctcgctcgtcgccctgcacctggccgtccgttcgctg
cgacagggcgaatgctcgctggccctggccggcggcgccaccgtcatgtcgacgccgaag
atgttcaccgagttctcccgccagcagggcctggcggccgacggccgctgcaagcccttc
gccgccggcgccgacggcaccgcctggtccgagggcgtcggcctgatcctgctggagcgg
ctctccgacgcgcagcgcaacggccacgagatcctcgccgtcatccggggttccgccatc
aaccaggacggcgcgtccaacggcctgaccgcccccaacggcccctcccagcagcggctg
atccgccaggccctcatcgacgccggtctcacctcgggcgaggtcgacgtcgtcgaggcg
cacggcaccggcaccaccctcggtgaccccatcgaggcgcaggccctcctcaacacgtac
gggcaggaccgcggtgacgcgcacccgctgctgctcggctcgctgaagtccaacaccggc
cacacccaggccgcttccggcgtcgccggggtcatcaagatggtgcaggccatgcgccac
ggcaccctgcccaagagcctccacgtcgacgcgcccaccccgcacgccgactgggcgacc
gggggcgtggaactgctcaccgagtccaccacctggcccgagaccggcaggccccgccgc
gccgccgtctcctccttcggcgtcagcggcaccaacgcccacctcatcctggaacaggcc
cccgaggaccaggccccccgcgcggaggaccccggcaccgggcccgccggaacgaccggc
gacgggacgtggcggtcgtggatggtgtcgggcaagtcgcgtgcggcggtgggggagcag
gcggcgcgtctggcggcgtcggtgcgtgcgtccgacgcgtcggtgctggacgtggcgcat
gcgctggtgtcgtcgcgtgtggcgatggaccggcgtgcggtggtcgtggggtccgaccgt
gaggagctgctcgcggggctggacgcgctggcggcgggtgagccgtccgtgcgtgtggtc
gagggcaccgccggtgagggtgcgggtgatgtggccttcgtgttcccgggtcagggttcg
cagtgggtgggtatggcggtggagttgttgggttcgtcgccggtgttcgcggggcgggtg
gcggagtgtgcggcggcgttggagccgttcacggagtggtcgttgctggatgtgctgaac
ggtgtggagggtgctgcgtcgttggagcgggtggatgtggtgcagccggtgttgtgggcg
gtgatggtgtcgttggcggaggtgtggcgggctcagggtgtggagccgggtgcggtgatc
ggtcattcgcagggggagatcgcggccgcggtggtggcgggcgggttgtcgttggaggac
ggggcgcgtgtggtggcgttgcggtcgcgtgcgttgcgtgcgttgtcgggtctgggcggc
atggtgtcggtcgctaggaacgtggacgaggttcgtggtctgctggcgggctgggagggg
cggatcggtgtggcggcggtcaatgggccgtcgtcggtggtggtgtcgggtgatgcggag
gcgttggacgagttcgtggccgcgtgtgacgcgtcgggtgtgcgggcgcgtcgggtggcg
gtggactacgcgtcgcactccgcgcatgtggagcggatcgaggaggagcttgccgggctt
ctggccccggtggcgccgcggtcgtgtgatgtgccgttctactcgaccgtctcggggcag
gtggtggacaccgctggtctggatgccgggtactggtaccggaatctgcgggggacggtg
gagttcgaggcggggacgcgtgcgttgctggccgacggtttccgggtgttcgtggaggtg
agtgcgcatccggtggtggcgaccggggtgcaggagaccatcgaggacgcgggcgttcag
gccggcgttgtcggcacgctgcggcgtgatgaaggtggtctggagcggttcgcgttgtcg
ctgggtgaggcgtgggcgctgggcgccgaggtggactgggagacgcattacgcgggcacc
cggccccgccacgtcgacctccccacctacccgttccgccgtgactggtactggctgacg
cccgccgagtcggccgcggcggcggccaccggcgaccccgccgacggcgacttctggtcg
gccgtcgagagcggcgatctcacccggctctcctccgtgctggaggtcaccggcgacgac
gtggaggcgttcggcacgctgctgcccgcgctggcgtcctggcgccgtcgccgcaccctg
cgttccaccctcgacacctggcgccaccgcgtcacctggaccgcgctgaccggcgccgac
gacgccgtccccgccggccgctggcccgccctcgtccccgccggccacgccgacgacccc
tgggtgcacgcggtgctggcagctctcacggcgcgcggcctgcgtgtcgagcgtcacgac
ctcaccggcgacgaggacaccgccgcgctcaccgccctgctcaccggaaccggtgacacc
gagaccgacggcgccgaaggcatcgcgggcgtcctctcgctcctcgccctcgacgagcgc
ccccaccccgaccaccccgccgtaccgcgcggcctcgccaccgccaaggagctgctgcac
gcgctgtccggcaccgaagcctccgtgtgggcgctgacccgcggcgccgtcgccgtcgac
agccgcgaccggctgacctcgcccgtccaggccgagacctggggcttcggacgcgccgtc
gccctggaactccccgacgcctggggcggcctcgccgacctgccagccgaccccgacgcc
cgcagcctcgcccgcctcgccacgctcctcggcggccccgaggaccagatcgccgtacgc
tcctccggcgcgtacgcccgtcggctggcccggatgccgctgcccgagccggcccgggcc
accgacgcagacgcggaactcgccgtgcgggccgccgacgacgacgggatcgccggctgg
ggcgaccacgacaccgtcctgatcaccggcggcaccggtgcgctcggcgcccacgtggcc
cgctcgctcgccgcctccggcgcccgccacctggtgctcaccagccgacgcggacccggc
agccccggtgccgccgaactcgtcgccgagctggaggagctgggtgcccgggtcaccgtc
gccgactgcgacgtggccgaccgcgaccagctcgcccgtctgctggactccctccccgcc
gacctccccctcaccggcgtcgtgcacgccgccggtgtcctggacgacggtgttctcgac
gccctcaccctggaccgcttcgaagccgtcctgcgccccaagaccctcggcaccgcccac
ctgcacgagctgacccgcgaccacgacgtcaccctgttcgtcctcttctcctcgatcgtc
ggtgtcctcggcaacgccggacaggccaactacgccgccgccaacgcctatctggacgcc
gtagccgagcagcggcgggccgagggcctgcccgtcacctccgtggcctggggcccgtgg
gccgacgcgggcatggccaccgccgacgtgctcgccgaccggatgagccacgacggcctc
gccccgatggaccccgtcaccgccgtcgccgcgctgcgcgccgccgtcgccgagggcatc
ccgcacgccaccgtcctcgatgtggactggcgcgcctacggcaccgccatgaccgcggcc
cggcccagcccgctcgtcggcgacctccccgaggtccgccgcgccctggaggcggcggcc
gccaccgcgcccgacacccacgccctgcgcgaccggctgcgcggcctcgcccccgccgaa
caggaccggctgctcaccgacctggtccgcgccgaggtcgccaccgcgctgcgccactcc
tcaccggaggccgtggacgtcaaccgtgccttcaaggacctgggcttcgactcgctgacc
gccgtggaggtccgtaaccggatcaccgccgccaccgacgtcaagctgcccaccaccctc
ctcttcgaccaccccaacaccacggcggtcgtcgcccacctgcgtaccctgctgctcggc
gacgagcgccccgccgccgcgcccgtcgtcgtctccgcgggcgtcaccgacgagcccatg
gcggtcgtcgccatggcctgccgcttccccggcggcgtcaccacgcccgaggaactgtgg
cacctcatggccgccgaggtggacgccgtctccaccccgcccgaggaccgcggctgggac
ctcgacgccctgtacgacccggaccccgaacgccacggcaccacctacagccgtgagggc
ggcttcatccaggacgtcgccggattcgacccggcgttcttcgggatctcgccgcgcgag
gccctggccatggacccgcagcagcggctcctgctggagacctcctgggagaccttcgaa
cgcgccggcatcgacccgggaaccctgcgcaacagcgccaccggggtcttcgtcggcagc
atcaccacggactaccaggtccgcctgggcggcgccgccgcccaggaacagctcgccggc
cacctcatgaccggcaacgcctccagcatcgcctccggccgcctgtcgtacacgtacggc
ttcgagggccccgccgtcaccatggacaccggctgctcctcgtccatggtcgccctccac
ctggccctgcagtcgctgcgcaccggcgagtgcacgatggccctggccggcggtgtcacc
gtcatgtccacacccgagccctacgtcgagttctcccggcagcggggcctggcggccgac
gggcgctgcaaggccttcgccgagggcgccgacggtatgggcttcgccgagggcgtcggc
ctggtcctgctggagcggctctccgacgcacgccgcaacggtcacccggtcctcgccgtg
gtccgcggctccgccctgaaccaggacggtgcgtccaacggtctgaccgcccccaacggc
ccctcccagcagcgcgtcatccgccaggccctcgccaacgcgggcctcgccccgggcgag
gtcgacgtggtcgaggcgcacggcaccggtaccccgctcggtgaccccatcgaggcgcag
gccatcctcgccacctacggccaggaccgcgacccggcccggccgctgctgctcggttcg
ctgaagtccaacatcggccacacccaggccgccgccggcgtcgccggcatgatgaagatg
atcctggcgatgcggcagggcaccctgcccaagagcctccacatcagccggccgacctcc
gtcgtggactggtcgagcggcgccgtccgcctcgtcaccgagtccaccccctggcccgag
accggccgtccgcgccgcgccggcgtctcctcgttcggcatcagcggcaccaacggccac
ctcatcctggaggaggccccggcccccgaacccgccgaggacgagccggccgacccgttc
accgagccctccgcggacgactcggccgacaccgtccggtcgtggatggtgtcgggtaag
tcgcgtgcggtggtgggggagcaggcggcgcgtctggcggcgtcggtgcgtgcgtccgac
gcgtcggtgctggacgtggcgcatgcgctggtgtcctcgcgtgtggcgatggaccggcgt
gcggtggtcgtggggtccgaccgtgaggaactgctcgccgggctggacgccctcgccgcc
ggggagccttccccgcgtctggtggaaggctcggtcggtgacggctccggcaaggtcgcc
ttcgtgttcccgggtcagggttcgcagtgggtgggtatggcggtggagttgttgggttcg
tcgccggtgttcgcgggtcgggtggcggagtgtgcggcggcgttggagccgttcacggag
tggtcgttgctggatgtgctcaatggtgtggagggtgctgcgtcgttggagcgggtggat
gtggtgcagccggtgttgtgggcggtgatggtgtcgttggcggaggtgtggcgggctcag
ggtgtggagccgggtgcggtgatcgggcattcgcagggggagatcgcggccgcggtggtg
gcgggtggtctgtcgttggaggacggggcgcgggtggtggcgctgcggtcgcgtgcgttg
cgtgcgttgtcgggtctgggcggcatggtgtcggtcgcaaggaacgtggacgaggttcgt
ggtctgctggcgggctgggaggggcggatcggtgtggcggcggtcaatgggccgtcgtcg
gtggtggtgtcgggtgatgcggaggcgttggacgagttcgtggccgcgtgtgacgcgtcg
ggtgtgcgggcgcgtcgggtggcggtggactacgcgtcgcactccgcgcatgtggagcgc
atcgaggaggagcttgccgggcttctggccccggtggcgccgcgttcgtgtgatgtgccg
ttctactcgaccgtctcgggacaggtggtggacaccgctggtctggatgccgggtactgg
tatcggaacctgcgggggacggtggagttcgaggcggggacgcgtgcgttgctggccgac
gggttccgggtgttcgtggaggtgagtgcgcatccggtggtggccaccggggtgcaggag
accatcgaggacgcgggcgtgcaggccggtgtcgtcggcacgctgcggcgtgacgagggt
ggtctggagcggttcgcgttgtcgttgggtgaggcgtgggcgctgggcgccgaggtggac
tgggagacgcattacgcgggcacccggccccgccacgtcgacctccccacgtatgccttc
cagcggcagcactactggccgcgtttcgccgagctgggcggtgacgtcagctcggccggc
ctcgactcgcccgaccaccccttgctcggtgcctccgtcgaactcgcgggcggcgacggc
ctggtggccacggcacggtggtcgctgcgtacccacccctggctcgcggaccacgcggtg
tccggcaccgtgatcgtccccggaaccgcgctcgtggagtccgtgatccgggccggagac
gtcctcggctgcggccggatcgaggaactggccctccaggcccccgtggtcctccaggaa
cgcggcgaggcacaggtccagatcggcgtcggcgaacccgacgcctccggccgccgtccc
gtcaccgtccacacccgcaccaccggccccgacggcgccaccgaggacctctggacgctc
cgcgcccagggcaccctcaccgagcccggcgcccccgccgtcgaccggcccgaggagttc
acctcctggccgccccccggcgccaccgccgtcgccgccgagggcttctacgagctgctc
gccggccgtggctacgagttcgggcccgtcttccagggcgtacgcgccacctggagccgc
ggagaggacctctacgccgaggtcgtcctgcccgagcagatccgcggtgacgccggacgg
ttcggcatccaccccgcgctcctcgacgccgccctgcacgccgcccacctcgcccccggc
agtgccgggcgcacggtcgtcccgttcacctggagcggggtctgcctgcacgccgccgga
gcgaccgcactgcgcgtccgcgtctccccggcagggcaggatgccatctccgtccagctc
accgacccgaccggcgcccccgtcgccaccatcgacgccctggccgtacgcgagatcgcg
ccggacaccctcgatccgtccgcccgcgccgcccgcgactggctgttccgcctcgactgg
acaccggtcacgccgcccgccgccgtcccggccgccaccggctgggccgtcctcggcacc
ccggccgacccggtcaccgcccccgacggcagcggaaccacactgcccgccttcgccacc
cccggcgcactggccgagcacaccgaggccaccggtcaccggccggacgccgtcctgctg
ttcgccggggccgccgcgtcgggcacggccgccgcgcccgacgccgagccgggcgtcccg
gacgccgtcctcgacgacgtgctcgccaccgtccagagctggctcgccgacgagaccacc
gagggcgttccgctggtcgtcgtcacccgcggcgccgtccccaccggccccgccgacccc
gcccacgacctgcccggcgccgccgtctggggcctggtgcgctccgcccagtcccagcac
ccgggccgcctcgtcctggcggacctcgacatccacgacgactcctggctcgccctgccg
gccgcactcgccgccggtgagccgcaactcgccctccgccagggcgccgcgtacgcgccg
cgcctggtccggccccgtacctccgacgccctcaccgtgcccgaggggaccgggaactgg
cgcctcgacatccccgagaaggggtccgtcgaccggctggacctcgtcgccgcccccggg
gcggccgaggagcccgccgccggcgaggtggtgatcgaggtgcgagccgccggactcaac
ttccgcgacgtcctcaacaccctcggcatgtaccccggccccgccgtgctcctcggcgcc
gaggcggccggtgtggtcaccgccgtcggcgagggagtcaccggcttcgccccgggcgac
cgcgtcatgggcctggtctccggcggcttcgccccccgcgccgtcgccgacgcccgcatg
ctcgcccccgtacccgacggctggacctgggcgcaggccgcctccgtccccgtcgccttc
ctcaccgcctactacggactgcgcgacctcgcccacctcgacgccggcgagtccgtcctc
gtccacgccgccgccggcggtgtcggcatggccgccgcccagctcgcccgccactggggc
gccgaggtctacggcaccgccggcgaccacaagcgcaccctgctgcgcgccgacggctgg
gacgacgcccacctcgcctcctcccgcaccctcgccttcgaggaccgcttccgcgccacc
agcggcggccgtggcgtcgacgtcgtcctcaactccctggccggcgactacatcgacgcc
tccctgcggctgctcgcccccggcggacgcctcgtcgacatgggcaagaccgatgtccgc
gatcccgggcaggtcctccgcgaccaccccgccgtcgccctctaccaggcgtacgaactg
cgtgaggccggtgaggaccgcatccaggagatgttccgcgacctgtcggaactcttcgcc
tccggagccctgcggcccctgcccaccgtcacctgggacgtgcggcacgcccgcgaagcc
ttccgccacatggcccaggccaagcactacggcaagatcgtgctcaccctgccgcgcgcc
tgggaccccgagggcaccgtcctcgtcaccggcggcgccggtgtcctcggcggcatcctc
gcccgccacctcgtcacccgccacggcatgcgccacctcgtcctcaccggccgccggggc
cccgacacccccggcgccggggaactcgccgccgagctgcgggaactgggcgccgaggtc
accctcgccgcctgcgacgcggccgacgccgacgccctcgccgcggtgctcgccgccgtc
cccgccgagcacccgctgactgccgtcgtccacgccgcgggcgtcctcgacgacggcgtc
ctcgaatccctcacccccgaccggctgcgcaccgtcctcgccccgaaggccgacgccgcc
cgccacctgcaccgcctcacccgcgacctcgacctcgcggacctggtgctgttctccgcg
ggcgccggcgtcttcggcaacgccggacaggccaactacgccgcggccaacacctacctc
gacgccctcgctcaccggcgccgggccgacggcctgcccaccacctccctctcctggggc
ctgtgggccgacaccagcgccctgaccggacagctcgacgacaccgacctcgcccgggtg
cgccgctccggcgtcctgccgctctccgccgccgacggcatggtcctcttcgacgccgcc
ctcaccgagcagcgcccccacctggtgccggtccgcctggagaccggacagctgcgcgcc
tccggcgacgaggtcccgcccctgctgcgctccctgtaccggggcccggtccggcgcacc
gccgaggccggcgccgccgccggtaccgacggcctgcgcgcccgcctggccggccgttcc
gccgaggaccggctcagcaccctgcgcgacctggtcggtgcccacgcggccgccgtcctc
ggccacgacgacaccgagccgttccacgccggccgcgccttccgcgacctcggcttcgac
tcgctgaccgccgtcgaactgcgcaaccgcctcagcgccgccaccggtctgcggctgccc
gccaccctcgttttcgaccacccgaccgtcgccgccctcgccgcccacctcgacggcgaa
ctctccgacggcaccccggccgcgctccccgccgcgcccgcacctgttcccgccgtgccc
ggcgacgacgaccccttcgccatcgtcggcatggcctgccgcctccccggcgacatccac
tcgcccgaggacctgtggcggctgctggccgacggcgccgacgccgtcgcgcccttcccc
gacgaccgcggctgggacctcgcccgcctctacgactccgtccccgagggccagggcagc
tcccgcacccgcgagggcggcttcctccacgacgccgccgacttcgacgccgacttcttc
ggcatctccccccgcgaggcgctcgccatggacccgcagcagcgcctcctcctggagacg
gcctgggagaccttcgaacgcgccggcatcgacccccgctcggtgcgcggcagccgcacc
ggcgtcttcgccggcctctcctccagcgactacctcaagcgcgtcacccacgtccccgac
gagatcgccggatacgtcaacaacggcaacgccaacagcatcgtctccggccgcgtctcc
tacaccctcggcctggagggcccggccgtcaccgtcgacaccgcctgctcctcctccctc
gtcgcgctgcacatggcgctgcaggccctgcgacgcggcgaatgcaccatggccctggcg
ggcggcgtcaccgtcatgtcctcgcccgagatcatcgtggacttctcccggcagcgcggc
ctcgccgccgacggccgctgcaagcccttcgccgaggccgccgacggcaccggcttctcc
gagggcgtcggcctgatcctcgtcgagcggctctccgacgcccgccgcaacggccaccag
gtcctcgccgtggtccggggctccgccgtcaaccaggacggtgccagcaacggcctcagc
gcccccaacggccccgcccagcagcgggtgatccgccaggccctcgccgacgcgggtgtc
ggcgccgccgaggtcgacgccgtcgaggcgcacggcacggggacccgcctcggcgacccg
atcgaggcccaggccctcctcgccacgtacggccgcgaccgggacggcggccacccgctg
ttcctcggctccgtcaagtccaacctcggccacacccaggccgcggccggtgtcgccggg
gtgatgaagatggtgctggccctgcgccaccgcctgctccccgagagcctgcacatcgac
gcgccgaccccgcacgtcgactgggcggactcgggcgtgcgcctgctgaccgaggccacc
gcgtggcccgagccctccgcctcccgcccgcgccgcgccgccgtctcctccttcggcatc
agcggcaccaacgcccacgtcatcctggaggaggcccccgccgcccccggcccggacggc
ggcgagccggagcccaccggcgccgacgcgacggagacccgccccacgcccctgccgtgg
gtgctgtccgcccgcagcgaggccgccctgcgcggccaggccaaggccctcctcacccac
ctcgacgcccaccccgggaccgaccccgccgacatcgcccacaccctggtcacgcgccgg
gcccagctggagaagcgggccgtcgtcgtcgggagcgccaccggcgacttccgcgccggc
ctcgccgccctcgccgagggcagccccgccgcccacgtggtgaccggcggccgcggagcc
ggacgcgaccgccggaccgtcctcgtcttccccggacagggctcccagtgggccggcatg
ggcgccgaactcctcgacgccagccccgccttcgccggccgcgtcgccgcctgcgaggag
gcgctcgccccctacgtcgactggtccctgaccgccgtcctgcgccaggaggagggcgcc
cccgccctcgaccgcgtcgacgtcgtccagcccgtcacctgggccgtgatggtcgccctc
gccgaggtgtggcgcgcccacggcctgcgtccggccgccgtcctcggccactcccagggc
gagatcgccgcggccgccgtcgccggggccctctccctcgccgacgccgccaggatcgtc
gcggtccgcagccgggccatcgcccgcgaactctccggacacggcggcatggtggccgtc
accgccccgcacgacgaggtgaccgccctcctcgccgatctgcccggcgtctgcgtcgcc
gccgtcaacggcccctcctccgtcgtggtctccggcgacaccggcggcctcgacaccctc
ctcgccgcctgcgaggaacagggcgtccgcgcccgccgcgtccccgtcgactacgcctcc
cactcggcccacgtcgaccggctcgccgagagcctgcccgccgccctcgacggcatcgag
ccccgcgacggcgacatccccttcttctccaccgtcaccgcggactggcaccccggcacc
ggactcggcgccgcctactggcaccgcaacctgcgcggcaccgtccgcctggaggagtcc
ctgcgggccctcgtcgagcagggccacgacgtcttcgtcgagtgcggcccgcacccggtg
ctcaccgtcggcatcgaggacaccgtcgccgccctcggcgccgacgcggtggccctcggc
tcgctgcgccgcgacgacggcggccccgcccgtgtcctgaccgccctcgccgccgcccac
gtcgaaggcgtccccgtcgactggcgccccgccgtgtcccacggcaccgccgtcgacctg
ccgacctacgccttccagcgccggcggtactggctggacgccggcaccccccagggcgac
ccggccggcctcgactccgtcgtccgcctggccgacggcggagccgtcctcagcggttcc
ctgtccctcgccacccagccctggctggatgcccaccggacccacggcgccgccgtcgtc
cccaccaccgccctgctggactgggcggtccgggccggcgacgagaccggcctgcccgtg
gtcgccgcactcgacgagcacagcccgctcgtcgtgcccgaggaggggcacgtcgagatc
cagctcaccgtctccgccgccgacaccgactcccggccgttctccgtccactcaaggctc
cacgccgccgacgccggtgagcccgccaccccctggacgcggaacgcgaccggcgccctc
accgaccggcccaccaccaccccgcagccctccggcacctggccgctcgccgacgccgtc
gcgggcgaccctgccccggcgcgcgccctcgccgaggaccgcggcctcgacctcgccgcg
cccttcgacacggtgcgctccctgtggcgcgccggcaccgacgtcctcgccgaggtcgca
cttcccgacaccgcacacgccgacgcggcgcgcttccgcctccacccggcgctcctccag
accccgctcgccctcgccgcgaccaccgaggaggccaccgcaccggtcctgcccgccgcc
tggcgggacgtcaccgtgcacgccaccggcgccaccaggctccgcgtccgcctcaccccg
ggggacgacgccacctggagcgtcgaagcccgcgacgccgcaggcgacctcgtcctcacc
ggcaccgccgtgacccgcccggccggccccgaccggctccccgccaccgccggccccgac
gccccgcaccgggtcgcctggctcccgtggaccgacagcacctcctccgccacccccgaa
ccacacggtccgtgggccgtcatcggtgcccccggacggctcaccgccgccctcgaacgc
agcggcgccaccgtccagctccacgccgacctggccgccctcaccaccgccctcgacaac
ggcgaggccgcacctcccgccctggtcgtcgccttccacggccacgacagcggcgaggac
ccgacgagggccgcgcacacctccgcgtcccgtgccctggagctgtccaccgcctggctc
cgggagccgcgcctggccggcgcccggctcctcctggtcaccgagggcgccgtcgccacc
ggcccggacgacaccgtccccggcctcgccgacgccaccgcctggggtctgctccgctcc
gcccagaccgagcaccccggacgcttcctcctggccgacctcgaccccgccctcggcgac
accgacgaggacagcgccgccgacaccctgatcgccgccgccgcggcggccgcgcgcacc
ggcgagcaccagttcgccgtacgggccggcaccgtcaccgtgccgcgcctggtccccgcc
gatcacccggagggcgcccccgcgcccgccgccaccgctccgtggggcgagggaaccggc
gccggcaccgtgctgatcacgggcggaaccggcaccctcggcgccctcgtcgcccgtcac
ctcgtcacccgccacggcgtacgccacctgctgctcaccagccgtcgcgggcccggcgcc
cccggagctgcggccctgcgcgaggaactcgccgcgctcggcgccgaggcagagatcgtc
gcctgcgacgtcgccgaccgcgagcaactggccggcgtcctcgacgccgtaccggccgaa
caccccctgaccgccgtcgtccacacggccggcgtcctggacgacggcacactggacggc
ctcacgcccgaccgcgtcgcccacgtcctgcggcccaaggccgacgccgcctggcacctc
cacgagctcacccgcgacaccaaactcaccgcgttcgtgatgttctcctcctacgcgggc
gtcgccggtggccccggccaggccaactacgcggccgccaacgccttcctcgacgccctc
gcgcaacaccgccgggcgagcggcctgcccgcgcactccctcgcatggggcctctgggag
gaccgcagcgacctgaccggcgccctcgacaccaccggcctggcccgcctggaacgctcc
ggcatccgccccctcaccgccggacaggggctcgccctcctcgacgcgagcaccgccctg
gacaccgcccacctcgtccccgtacggctcgacacccgcaccctgcgcgccgacgaggcg
cccccgctgctgcgggccctggcccgcccggccgtacgacgcgccgccgactccgggccc
gacgcggccaccggcgctccggcggacctccgtgagcggctggccggactcagcggcccc
cagcagcgggcgctgctgcaccgtacggtcctcggtcacctcgccgccgtcctcggccac
gcctccgccgcgtccctcgacgcggaccgcggcttcctcgacctcgggatgtcctcgctg
accgcggtcgaactccgcaaccggctcaacgccgacatcgggctctccctgcccaccacc
ctgatcttcgaccacccggacccggccgccctcgtacgccacctccagaccgaactcggc
acaggcgccggcgaacccgaccaggccgtcttcgccgaactggccgccctggagaccgcc
gtcggcggggccgccctcgacgaccaggaccgcgcccgcctggcgcagcgactcaaggcc
ctcgggtggaagctcgacgccacctcccaggacgccgacgagcccgacgacgactccgac
ctcgacaccaccacggacgacgagatgttcgacctcatcgacaacgaactcgggctcgcc
tga

DBGET integrated database retrieval system