KEGG   Salinibacterium sp. CGMCC 1.16371: C2138_01145Help
Entry
C2138_01145       CDS       T05414                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
salc  Salinibacterium sp. CGMCC 1.16371
Pathway
salc00564  Glycerophospholipid metabolism
salc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2138_01145
Enzymes [BR:salc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C2138_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AWB88336
LinkDB All DBs
Position
222784..224523
Genome map
AA seq 579 aa AA seqDB search
MAEQLKGGRKTVTHSSTLGPDDRAAAIESLKTRELDILVIGGGIVGTGCALDAVTRGLSV
GMVEARDWGSGTSSRSSKLVHGGIRYLEQLDFRLVREALIERGLLLQRIAPHLVKPVRFL
YPVRNIVERCYVGAGMILYDIFARTGGRPPGVPRHRHYTKRQVQRGIPSLKKDAFAGGIA
YYDAQVDDARYVSSLARTASFYGAKVASRVRVEGFVKVGQRVVGVTAHDLESGERFEIRA
RQVINATGVWTDDTQRMVGERGTFKVRASKGVHLVVPRDRFQSKVGLLLRTEKSVLFVIP
WGRHWLIGTTDTKWDLDKAHPAATAADIDYLLDHVNSVLAVPLTRDDVEGVFAGLRPLLA
GESDETSKLSREHTVAHTVPGLVVVAGGKWTTYRVMAKDAVDAASAALDGRVPRSTTEEI
ALLGAEGYQAAWNKRAKIARAFGVHKVRIEHLLNRYGTLTDELLDLIRDDPSLNTPLPGA
DDYLEAEVVYAASHEGALHLDDVLARRMRVSIEAWDRGVSAAPVAARLMARVHGWDEERI
DREVSLYVARVAAERASQEQPDDASADRVRLEAPDYTAR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaacagctcaagggcgggcgcaagacggtaactcactcgtcaacgctcggcccg
gatgatcgcgcggcggcaatcgaatccctcaagacccgcgagctcgatattttggtgatc
ggcggcggcattgtcggcaccggatgcgcgctcgacgcggtcacccgcggtttgagcgtg
gggatggtcgaggcgcgggactggggctccggcacgtcgagccgctcgtccaagctcgtg
catggcgggatccgctatctcgaacagctcgactttcgtctcgtgcgcgaggcgctcatc
gagcggggcctgctgttgcagcgcatcgcccctcatctggtcaagcccgtgcggtttctc
taccccgtccgcaacatcgtcgagcgttgctacgtgggcgccggcatgatcttgtacgac
atttttgcccgcacgggtggccgcccgccgggggttccccgccacaggcactacacgaaa
cgtcaggttcagcgcggtatcccgagcctcaagaaggatgctttcgccggcggaatcgcc
tattacgacgcccaggtcgacgacgcccgctacgtgtcgagcctggcgcgcacggcatcc
ttctacggagccaaggtcgccagtcgcgtacgcgtcgagggcttcgtgaaggtgggccag
cgggttgtgggcgtcaccgcgcacgacctggagtcgggtgagcgttttgagatccgcgcc
cgtcaggtgatcaacgccaccggcgtgtggaccgatgacacccagcgcatggtgggtgag
cgcggcacgttcaaggttcgcgcttcgaagggcgtccaccttgttgtgccgagagaccgg
tttcagtcgaaggtcggcctgctgctgcgcacggagaagagtgtgctgttcgtgattccg
tggggccgtcactggctgatcggtacgacagataccaagtgggatctcgacaaggcccac
cctgctgcgacggccgccgatatcgactacctgctcgatcatgtgaactcggtgcttgcg
gttcccctcacccgcgacgacgtggagggggtgttcgcggggctgcgtccgctgctggcg
ggggagtcggacgagacctcgaaactctcgcgtgaacacacggttgcgcacactgtgccc
ggcctcgttgtggtcgccggcggcaaatggaccacctaccgggtgatggccaaggatgct
gtggacgcggcatccgcagctctcgacggacgggtgccgcggagcacgaccgaggagatc
gccctactcggcgccgagggataccaggccgcgtggaataagcgggccaagatcgcccgc
gcttttggcgtgcacaaggtgcgcatcgagcacctgctcaaccgctatggaacgcttacg
gatgagctgctcgatctgatccgtgacgatcccagcctcaatactcccttgcctggcgcc
gacgactaccttgaagccgaggttgtctatgcggcgtcgcacgagggcgccctgcatttg
gatgatgtgctcgcccgacggatgcgcgtgtcgatagaggcgtgggaccgtggcgtttct
gcggcccccgttgccgcgaggctgatggcacgggtgcatggctgggacgaggaacgcatc
gaccgcgaggtgtcgctctacgttgccagggtcgcggcggagcgggcgagtcaggaacaa
cccgacgacgcgtcggcagaccgggtgcggctcgaagcgcccgattacacggcgcgctag

DBGET integrated database retrieval system