KEGG   Salinibacterium sp. CGMCC 1.16371: C2138_01345Help
Entry
C2138_01345       CDS       T05414                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
salc  Salinibacterium sp. CGMCC 1.16371
Pathway
salc00020  Citrate cycle (TCA cycle)
salc00480  Glutathione metabolism
salc01100  Metabolic pathways
salc01110  Biosynthesis of secondary metabolites
salc01120  Microbial metabolism in diverse environments
salc01130  Biosynthesis of antibiotics
salc01200  Carbon metabolism
salc01210  2-Oxocarboxylic acid metabolism
salc01230  Biosynthesis of amino acids
Module
salc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:salc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2138_01345
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2138_01345
Enzymes [BR:salc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C2138_01345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AWB88371
LinkDB All DBs
Position
265833..267050
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQKIKDTLIHPYLDVTLEYYDLGIESRDATDDQITIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGVIFREPIIISNIPRL
VPGWNKPIIIGRHAFGDQYRATDFKFQGKGKLTVEFEPEDGSEPMKFEVYDAPGDGIAQV
QYNLDSSIIDFARASLNYGLSRNYPVYLSTKNTILKAYDGRFKDIFEEVYETEFKAQFEA
AGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLSTPDGK
VVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIYAWTRGLAHRGKLDGNQALIDFSLTLED
VVIKTVESGKMTKDLALLVGPDQAYQTTEEFLATLDENLKARMAA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagatcaaggttgaaggaacggtcgtcgagctcgacggagacgagatgactcgc
atcatctggcagaagatcaaggacaccctgatccacccctacctcgatgtgaccctcgag
tattacgacctcggcattgagagccgcgacgcgaccgatgaccagatcacgatcgacgca
gcccacgccattcagaagcacggcgtcggcgtcaagtgcgcgaccatcacccccgacgag
gcccgcgtcgaggagttcggcctcaagaagatgtggaagtcgccgaacggcacgatccgc
aacatcctcggcggcgttatcttccgcgagccgatcatcatctcgaacatcccgcgtctg
gttcccggctggaacaagccgatcatcattggccgccacgccttcggtgaccagtaccgc
gccacggacttcaagttccagggcaagggcaagctcacggttgaattcgaacccgaagac
ggctcagagcccatgaagttcgaggtctacgacgcacccggcgacggcatcgcccaggtt
cagtacaacctcgactcgtcgatcatcgactttgctcgcgcgtcgctcaactacggcctc
agccgcaactaccccgtctacctgtcgacgaagaacacgatcctcaaggcatacgacggc
cgcttcaaggacatcttcgaagaggtctacgagaccgagttcaaggcgcagttcgaggcc
gccggtctcacctacgagcaccgcctcatcgacgacatggtcgcttcggccatgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgttcagtcggacaccgtc
gcgcagggcttcggctcgctcggcctcatgacctcggtgctcagcacgccggacggaaag
gtcgtcgaggcggaggctgcccacggcaccgtcacgcgtcactaccgccagcaccaggcc
ggcaagcccacctcgaccaacccgatcgcctcgatctacgcctggacgcgcggtctcgcg
caccgcggcaagctcgacggcaaccaggctctgatcgacttcagcctcacgcttgaggat
gttgtcatcaagacggtcgagtcgggcaagatgaccaaggacctcgcattgctcgtcggg
cccgaccaggcctaccagacgaccgaggagttcctcgcgaccctcgacgagaacctcaag
gctcgtatggcagcgtaa

DBGET integrated database retrieval system