KEGG   Salinibacterium sp. CGMCC 1.16371: C2138_05545Help
Entry
C2138_05545       CDS       T05414                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
salc  Salinibacterium sp. CGMCC 1.16371
Pathway
salc00640  Propanoate metabolism
salc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C2138_05545
Enzymes [BR:salc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     C2138_05545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: AWB89075
LinkDB All DBs
Position
1133479..1134534
Genome map
AA seq 351 aa AA seqDB search
MKALVYEGPGQKSWKDVPDPKITHPTDVIVKIDTTTICGTDLHILKGDVPAVTPGRILGH
EGVGTITEIGDAVTTLKVGDQVILSCVSACGKCSFCKQGVYSHCLGEEGASGIGWIFGHL
IDGTQAEYVRVPYAENSVYPLPQGVNTQMGTLLSDILPTGHEIGVQYGAVKAGDVVAVVG
AGPVGLASIATAGLYGPSRVIAIDLDSNRVEQAKKFGATDGVVSSAADWKEQVLALTDGL
GVDVAIEAVGVPQTFEMCLDIVRPAGHVANVGVHGKSVDFDLQNLWISNIVISMGLVNTD
TLGTLLKLVAQGKIPAEHFISHTFALGDIMEAYDVFGRAAETKALKVMLNA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttgtgtacgaaggcccgggtcagaagtcctggaaggacgtgccagacccg
aagattacccatccgaccgacgtaatcgtcaagatcgacacgaccacaatctgtggcacc
gacctccacattctcaagggtgacgtccccgcggtgaccccgggtcgaatcctcgggcac
gagggtgttggcaccattactgagatcggcgatgctgtcacgaccctgaaggtgggcgat
caggtgattctgtcctgcgtctcggcgtgcggaaagtgcagcttctgcaagcagggcgtt
tattcgcactgtctaggcgaagaaggcgcttcgggcatcggctggatcttcggtcacctc
attgacggtacccaggcggagtatgtgcgggttccctatgccgagaactcggtctatcca
ctgccgcagggggtcaatactcagatgggaacgctgctgtcggacatccttcccacgggg
cacgagatcggcgtgcagtacggcgcggtcaaggcaggcgatgttgtcgccgttgtcggc
gccggcccggtcggtctcgcttctatcgccaccgcagggctctatgggccgtcgcgcgtc
atcgccatcgatctcgactccaaccgtgtggagcaggccaagaagtttggcgcgacggac
ggggtcgtgtcgagtgctgctgactggaaggagcaggtgctcgccctgacggacggactg
ggagtcgatgtcgcgatcgaggcggtgggtgttccgcagacatttgagatgtgcctggat
attgtgcgtccggccggtcacgtcgccaacgtgggagtgcacggcaaatcggtggacttc
gatcttcaaaacctgtggatctcgaacatcgtcatcagcatgggcctcgttaacaccgac
accctaggaacgctgctcaagctggtcgcgcagggcaagattccggccgagcacttcatc
agccacacctttgccctcggcgacatcatggaggcctatgacgtctttggacgggccgca
gagaccaaggcgctcaaggtaatgctcaacgcttag

DBGET integrated database retrieval system