KEGG   Salinibacterium sp. CGMCC 1.16371: C2138_08360Help
Entry
C2138_08360       CDS       T05414                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
salc  Salinibacterium sp. CGMCC 1.16371
Pathway
salc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:salc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    C2138_08360
Enzymes [BR:salc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C2138_08360
DNA repair and recombination proteins [BR:salc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C2138_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AWB89551
LinkDB All DBs
Position
1737466..1739904
Genome map
AA seq 812 aa AA seqDB search
MATRTHDDEQTVSIDGRKLRITRLDKVLYPETGTTKADVLDYFVRIADTMIPHTADRPAT
RKRWVHGVGTTDQPGQVFFQKNLDASAPHWIASREIQHRDHTNTYPLVNDRATLAWFAQM
AALEIHVPQWRFGRTGAHRNPDRFVLDLDPGEGAGLQECAEVARIARSILVDMGLDPMPV
TSGSKGIHLYAALDESRDSDAISAVAHELARALEADHPDLIVSDMKKALRGGKVLVDWSQ
NNASKTTIAPYSLRGRSHPMVAAPRTWEELDDPQLRHLDYTEVLERVATMGDPLAGLTAG
HFDSLEPTAAHMATFAATPETENRLEKYRSMRNAAKTAEPMGDSPTATPSPDAPTFVIQE
HHARRLHYDFRLEHDGVLVSWALPKGVPTDPAKNHLAVQTEDHPLDYGAFEGTIPAGEYG
AGDVTIWDSGTYDLEKWREGKEVIVTIDGERHGRHRYALIHTGAEPQTWLIHLMEKNGSA
PAPKRAASRTAAPAPMLASVADSGQLGMLAHDKDDWAFEMKWDGIRCIATVEDGEVRLTS
RNGNDLTVTYPELSELATAVEGDAVLDGEIVALNRKGRPDFGTLQQRMGVTRAAEVEAAR
EKNPVQLMVFDVLRQGNESLLPMTYDVRRERLQSAVTENSTIRVPDAFSGDLDAAMATSI
ELGLEGVMAKRRTSSYTPGRRSRSWIKIKHHHTQEVVIGGWRPGKGARSGLVGSLLLGVP
TDEGLRYVGRVGTGFTEKQLEAAAAKMRRLERKSSPFIEVPGADARDAHWVTPSLVGEVE
FSEWTATQRLRHPTWRGWRPDKDPDDVTIEQP
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccgaacccacgacgatgagcagaccgtaagcatcgacggcagaaagctcagg
atcacccggctcgacaaggtgctctaccccgagaccggcaccacgaaggccgatgtgctc
gactactttgtgcgcatcgccgacacgatgattccgcacaccgccgaccgcccggccacg
cgaaagaggtgggttcacggcgttggcacgaccgaccagccggggcaggtgttttttcag
aagaacctcgacgcgtcggccccccactggattgcgtcgcgggagatccaacaccgcgac
cacaccaacacgtaccctctggtcaacgacagagccacgctggcctggtttgcacaaatg
gccgccctcgagatccatgtgccgcagtggaggttcggccgcacgggagcgcacagaaac
cctgaccgctttgtgctggacctcgaccccggcgaaggggcgggtctgcaggagtgcgcc
gaagtcgccaggattgcgcgcagcatcctggtcgatatggggctggacccgatgcccgtg
accagcggcagcaaaggcatccacctctatgccgcactggacgaatcccgcgactccgac
gcaatctcggcggttgcccacgaactcgcccgtgcgctggaggccgaccatcccgacctc
atcgtgagcgatatgaaaaaggcactccgtggaggaaaggtgctggtggactggagtcag
aacaacgcatcaaagaccacgatcgcaccgtactcgcttcgggggcgatcacacccgatg
gtcgccgcgccgcggacatgggaggagcttgatgacccccagctccgtcatcttgactac
acagaagtgcttgagcgtgtcgccacgatgggtgacccgctggccggcctgaccgcagga
cacttcgactcgctggagccgaccgcggcccatatggccacgttcgccgcgaccccagaa
acagagaaccgactggagaagtaccggagcatgcgcaatgcggcgaaaaccgcggagccc
atgggcgactcccccaccgcgaccccctcacccgatgcccccaccttcgtaattcaggag
caccacgccaggcggctccactatgactttcgcctcgaacacgacggagtgctggtgagt
tgggcgctgcccaaaggggtaccaacggatcccgccaagaaccatctcgcggtgcaaacc
gaggatcatccgctggactacggcgccttcgaaggaaccatccctgccggcgaatatgga
gcaggtgacgtgaccatctgggattccggcacctatgacctcgaaaagtggcgcgagggc
aaagaggtcatcgtcaccatcgacggcgagcgccacggccgtcatcggtacgctctcatc
cacaccggcgccgagccgcagacctggctcatccacctgatggagaagaacggttccgcc
ccggcacccaaacgagccgcatcccgcaccgcggcgccagcccccatgctggcaagcgtc
gccgattccgggcagctggggatgctcgctcatgacaaagacgactgggcgttcgagatg
aagtgggacggcatccgctgcatcgccacggtcgaggacggggaggttcgactcacgagt
cgcaacggcaacgacctcaccgtcacctacccggaactttcggagcttgcgaccgcggtc
gaaggcgacgccgtgctcgacggcgagatcgtagctctcaaccgaaagggccggcccgac
ttcggcacgcttcagcaacggatgggggtcacccgagcagccgaggtcgaggcggcccgg
gagaagaaccccgtgcagttaatggtgttcgatgtgctgcgtcaaggcaatgagtcactc
ttgccgatgacctacgacgtgagacgagagcgtctccagtccgcggtgacagagaactcg
acaattagagttcccgatgccttctcgggggatctggatgccgccatggcgacgagcatt
gagctcggtctcgaaggggtaatggcgaaacggcgcacaagctcatacacgccaggacgc
cggtcccgcagctggatcaagatcaagcatcatcacacccaggaggttgtcatcggcggc
tggcgcccgggcaagggtgcgagatcgggtcttgtcgggtctcttcttctcggagtccct
acggatgagggactgcgctacgtcggcagagtgggaaccggatttactgagaagcagctc
gaggccgccgctgccaaaatgcgaaggctcgaacgcaagagctcaccattcatcgaggtg
ccaggtgcggatgcccgagatgcgcactgggtcacaccctcactcgtcggcgaggtcgag
ttctccgagtggacggccacacaacgcctccggcacccgacgtggcgaggctggcggccc
gacaaggacccagacgatgtgacgatcgagcagccgtga

DBGET integrated database retrieval system