KEGG   Salinibacterium sp. CGMCC 1.16371: C2138_11355Help
Entry
C2138_11355       CDS       T05414                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
salc  Salinibacterium sp. CGMCC 1.16371
Pathway
salc00250  Alanine, aspartate and glutamate metabolism
salc00410  beta-Alanine metabolism
salc00430  Taurine and hypotaurine metabolism
salc00650  Butanoate metabolism
salc01100  Metabolic pathways
salc01110  Biosynthesis of secondary metabolites
salc01120  Microbial metabolism in diverse environments
salc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:salc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C2138_11355
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2138_11355
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2138_11355
   00430 Taurine and hypotaurine metabolism
    C2138_11355
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C2138_11355
Enzymes [BR:salc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C2138_11355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWB90061
LinkDB All DBs
Position
complement(2358880..2360304)
Genome map
AA seq 474 aa AA seqDB search
MNAKASDPTNETSPNAFTGYGDFNQLNPLFARPGEATDFPLDQIPAGESLPETAYQIVHD
ESMLDGNARLNLATFVGTWMDDHAIKLYMESADKNMIDKDEYPQTAAIETRCWKMIARLW
NAPDAENSIGTSTIGSSEACMLGGLALKRRWQLARRAAGKSTDKPNLVLSSAVQVCWEKF
CNYWDVEARFVPISLEHKVLDGHDLEQYVDENTIGVVAIMGVTYTGMYEPVAEIAAALDR
IQDKTGLDVKIHVDGASGGMIAPFLQTDLEWDFRVDRVVSISTSAHKYGLVYPGLGWVVW
RTVGDLPEDLVFEVSYLGGTMPTFALNFSRPGAQVLLQYYLFLRLGWDGYRRVQQASHDV
ALYLSGEIAAISAFELWNDGSDIPVFAWQLKEGYTDKWNLYHLSERLRLKGWLIPAYPMP
DDISDLVVQRIVVRNGFSRNLAESLVIDIKEAVEYLDRLETPIPAEGQVTSFTH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctaaagcctctgaccccacgaacgaaacgtcccccaacgccttcacgggctat
ggagatttcaatcaactgaatccgttgtttgccaggccgggagaagccaccgactttccg
ttggatcagattcctgcgggcgaatccctacctgagacggcgtaccagatcgtgcacgac
gagtcgatgctcgacggtaacgctcgactgaatctggccaccttcgttggaacgtggatg
gacgaccatgcgatcaagctctacatggaatccgccgacaagaacatgatcgacaaagac
gagtatccgcagaccgcggcaatcgagacgcggtgctggaagatgattgccaggctgtgg
aatgctcccgacgccgagaactcgatcggcacatcaacaatcgggtcgtcagaagcgtgc
atgctgggcgggctagcgctcaagcgccgctggcagttggccaggcgggcagcgggcaaa
tcgaccgataagccgaacctcgtgctctcaagcgcagtgcaggtgtgttgggagaagttc
tgcaactactgggacgtcgaggcccggtttgtgcccatttcgcttgagcacaaggtgctc
gacgggcatgacctcgaacagtatgtcgacgagaacaccatcggtgtcgtcgccatcatg
ggcgttacgtacaccggaatgtatgagccggttgcagagatcgccgccgccctcgatcgc
atccaagacaagacgggtctcgacgttaagatccacgtcgacggtgcttcgggaggaatg
atcgcaccgttcctgcagacagacctggagtgggacttcagggtggatcgggtggtctcg
atcagcacctctgcccataaatacggcctcgtctatccggggctcggctgggttgtgtgg
cgcaccgtgggggaccttcccgaggacctggtctttgaggtgagctacctcggcggcacg
atgcccacgttcgccctcaacttttcgcgaccgggcgcacaggtgctgcttcagtactac
ctgttcctccggctgggatgggacggctatcgccgagttcagcaagcgtcgcatgacgtt
gctctctatctctcgggtgagatcgcggcaatcagcgcgttcgagctgtggaatgacggc
agcgacattcctgtgttcgcctggcagctgaaggagggctacaccgacaagtggaacctc
taccacctctcagagagactgcggctcaagggatggctgattccggcctacccgatgccc
gatgacatctccgatctcgttgtgcagcgcatcgtggtgcgcaacgggtttagccgcaat
ttggccgaatcgctcgtgatcgacatcaaagaggctgtcgaatatctcgaccgcctcgag
actccaatcccggctgagggccaagtgacctcctttactcactga

DBGET integrated database retrieval system