KEGG   Salinibacterium sp. dk2585: FVA74_00730
Entry
FVA74_00730       CDS       T06151                                 

Definition
(GenBank) 4-oxalocrotonate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
sald  Salinibacterium sp. dk2585
Pathway
sald00362  Benzoate degradation
sald00621  Dioxin degradation
sald00622  Xylene degradation
sald01100  Metabolic pathways
sald01120  Microbial metabolism in diverse environments
sald01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sald00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FVA74_00730
   00622 Xylene degradation
    FVA74_00730
   00621 Dioxin degradation
    FVA74_00730
Enzymes [BR:sald01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     FVA74_00730
SSDB
Motif
Pfam: FAA_hydrolase ComJ
Other DBs
NCBI-ProteinID: QEE60250
UniProt: A0A5B9G198
LinkDB
Position
135320..136099
AA seq 259 aa
MTDWTIDRAARHLLDAEAERRDITRITDEWAELDIPTGYQVQDAVIDDKVANGHTVVGVK
LGLTSRAKQLRMGIDSPLTAVITDRMYLEAGVPVDLERFIHPRIEPEIVFTMKADLVGPG
VTVASAMAAVGTVHAGFEIIDSRYRDFSFAMPDVIADNASSAGYYIGGTALDPRDIDLAL
EACVLRVNGEVVDTATGAAVQGHPGEALALAANSLAARGKHIRAGDIVLTGGLTDAVFVN
QGDQISASFTHLGSIVVGT
NT seq 780 nt   +upstreamnt  +downstreamnt
atgactgactggaccatcgaccgcgccgcccgccaccttctcgacgcggaggcggagcgc
cgcgacatcacccgcatcaccgatgagtgggccgagctcgacatcccgaccggatatcag
gtgcaggatgcggtcatcgacgacaaggttgccaacggccatacggtggtcggtgtcaag
ctgggactcacctcgcgggcgaagcagctccggatgggcattgactcgccccttacggcc
gtcatcaccgaccgcatgtacctcgaagcgggcgtgccggttgacctcgaacgcttcatc
cacccacgcatcgaaccggagatcgtcttcacgatgaaggcagaccttgtggggccgggt
gtgactgtggcgagcgcgatggccgccgtgggtacggtgcacgcgggcttcgagatcatc
gacagccgctaccgcgacttcagtttcgcgatgcccgacgtgatcgcggacaacgcctca
tcggccggctactacatcggcggcacggcgctcgatccccgcgacatcgacctagcgctg
gaggcctgtgtgctgcgcgtcaacggggaggtcgtcgacactgcgacgggcgccgccgtg
cagggccaccccggcgaggcgctcgccctcgcggcgaactcgctcgcagcccgcggcaag
cacattcgtgcgggcgacattgtgctgacgggcggcctcactgacgcagtcttcgtcaac
cagggcgaccagatctcggcatcgttcacgcacctcgggtcgattgtggttggaacatag

DBGET integrated database retrieval system