KEGG   Salinibacterium sp. dk2585: FVA74_07670Help
Entry
FVA74_07670       CDS       T06151                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
sald  Salinibacterium sp. dk2585
Pathway
sald00270  Cysteine and methionine metabolism
sald00450  Selenocompound metabolism
sald01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sald00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FVA74_07670
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FVA74_07670
Enzymes [BR:sald01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     FVA74_07670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: QEE61469
UniProt: A0A5B9G6M0
LinkDB All DBs
Position
complement(1638462..1639661)
Genome map
AA seq 399 aa AA seqDB search
MTRRPDKHEPSTLRDLSRAVHAGNAVDAGTGAVRTPIVMANSYALPEDPSSISWSSAEAT
IYTRNGAANQKLLQQKLALLDHGEDSVVLASGVAALHAVFFTFLRTGDHAIIADQTYEAS
FRLFDELLPEKYGIEASFVDTSDLEAVRAAVRPNTKLIHTETIANPTTRLADVAALADIA
HDAGALLSVDSTFTPPPLSVPLDDGADLVVHSLTKYINGHGDAMGGSVAGAAELIGRIKA
DAMVDVGGVISPFNAWLITRGSVTLPLRIRQHVASALRVAEFLDADPRVAYTYYPGLSSH
PQHQLARRVLPHGFGGVMAFAVDGDADTQNRFVSQLRVITSAVSLGHDESLIVHVGTSGP
RVAHYPEEFRRYGHLRLSIGLEDADDLIDDLRSALDATF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgacgccctgataaacacgagccatcgaccctccgagacctcagccgggcggtg
cacgcgggcaatgcggtcgacgcgggcacgggtgcggtgcgcaccccgatcgtcatggcg
aactcctatgcgctgcccgaggatcccagctcgatcagctggtcgtccgccgaggcgacc
atctacacccgcaacggtgccgcgaaccagaagctgctccagcagaagcttgcgctcctc
gaccacggggaggattcggtggtgctcgcgagcggggtcgccgccctccacgcggtgttc
ttcacattcctgcgcacgggtgaccacgcgatcatcgccgaccagacctacgaggcgagc
tttcggctcttcgacgagctgctccccgagaagtacggcatcgaggcgagcttcgtcgac
acctccgacctcgaggcggttcgcgcggccgtccggcccaacacgaagctgatccatacg
gagacgatcgctaaccccacgacacggctggcggatgtcgcggccctcgccgacatcgca
catgacgccggcgccctcctcagtgtcgactcgaccttcacgccgccaccgctctcagtg
ccgctggatgacggtgccgacctcgtcgtgcactcgctcacgaagtacatcaacgggcac
ggcgacgccatgggcggttccgtcgcgggcgccgccgagctcattggccgcatcaaggcg
gatgccatggtcgatgtcggaggagtcatcagccccttcaacgcgtggctcatcacgcgg
ggttcggtgacgctgcccctgcgcatccggcagcacgtcgcatccgctcttcgcgtcgcg
gagttcctcgacgccgacccgcgcgtggcgtacacgtactacccgggcctcagctcgcac
ccgcagcaccagctcgcccggcgcgtgctgccgcacggcttcgggggtgtcatggccttc
gcggtcgatggcgacgccgacacgcagaaccgtttcgtatcgcagctccgcgtgatcacg
tccgcggtgtcgctcgggcacgacgaatcgctcatcgtgcacgtcggcacctcgggccct
cgcgtcgcccactatccggaggagttccgccgctacgggcacctgaggctctcgatcggc
ctggaggacgccgacgacctcatcgatgacctgcgctccgccctcgacgcgacattctga

DBGET integrated database retrieval system