KEGG   Streptomyces alboflavus: SMD44_00777Help
Entry
SMD44_00777       CDS       T05221                                 

Definition
(GenBank) peptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
salf  Streptomyces alboflavus
Pathway
salf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:salf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SMD44_00777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:salf02000]
    SMD44_00777
Transporters [BR:salf02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    SMD44_00777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 ABC_ATPase
Motif
Other DBs
NCBI-ProteinID: ARX81379
UniProt: A0A1Z1W4Q5
LinkDB All DBs
Position
879420..880457
Genome map
AA seq 345 aa AA seqDB search
MTAFLDVRDLKVHFPTDDGLVKSVDGLSFQLEKGRTLGIVGESGSGKSVTSLAVMGLHTA
GQYGRRKARISGEIWLDGTELLSAGPDHVRGLRGREMAMIFQDPLSALHPYYTIGKQIVE
AYRIHHDVGAKSARRRAVEMLDRVGIPQPDKRVDSYPHEFSGGMRQRAMIAMSLVNNPEL
LIADEPTTALDVTVQAQILDLIRDLQREFGSAVVIITHDLGVVAELADDILVMYGGRCVE
RGPADRVFHEPRHPYTWGLLGSMPRLDRDQQERLIPVKGSPPSLINRPSGCAFHPRCPYA
DVPKDDVTRTVRPELTEVGGRHWAACHMSAEQQKRIWAEEIAPKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgttcctggacgtgcgcgacctgaaggtgcacttccccaccgacgacggcctg
gtgaagtccgtcgacgggctcagcttccagctggagaagggccggaccctcggcatcgtg
ggcgagtccggctccggcaagtcggtgacctcgctcgccgtcatgggcctgcacaccgcc
ggccagtacggcaggcgcaaggcacggatatcgggcgagatctggctggacggcaccgag
ctgctctcggcgggccccgaccacgtacggggactccgcgggcgcgagatggccatgatc
ttccaggacccgctgtccgcgctgcacccgtactacacgatcggcaagcagatcgtggag
gcgtaccggatccaccacgacgtcggggcgaagtccgcccgcaggcgggcggtcgagatg
ctcgaccgggtcggcatcccgcagccggacaagcgggtggacagctacccgcacgagttc
tccggcggcatgcgccagcgcgcgatgatcgcgatgtcgctggtcaacaaccccgagctg
ctcatcgcggacgagccgaccaccgccctggacgtgacggtgcaggcgcagatcctggat
ctgatccgggacctgcagcgggagttcggatccgcggtcgtcatcatcacccacgacctg
ggggtcgtcgccgagctggccgacgacatcctggtgatgtacggcggccgctgcgtcgag
cgcggcccggcggaccgggtgttccacgaaccccggcacccctacacctggggcctgctc
ggctcgatgccgcggctcgaccgcgaccagcaggaacgtctcatcccggtcaagggctcc
ccgccctccctcatcaaccgcccctccggctgcgccttccacccgcgctgcccgtacgcc
gacgtcccgaaggacgacgtcacccgcacggtccgccccgaactgaccgaggtcggcggg
cggcactgggccgcctgccacatgtcggccgagcaacagaagcgcatctgggccgaagag
atcgcgccgaagctgtga

DBGET integrated database retrieval system