KEGG   Streptomyces alboflavus: SMD44_01123
Entry
SMD44_01123       CDS       T05221                                 

Definition
(GenBank) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
salf  Streptomyces alboflavus
Pathway
salf00052  Galactose metabolism
salf00500  Starch and sucrose metabolism
salf01100  Metabolic pathways
salf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SMD44_01123
   00500 Starch and sucrose metabolism
    SMD44_01123
Enzymes [BR:salf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SMD44_01123
SSDB
Motif
Pfam: Alpha-amylase DUF3459 hDGE_amylase
Other DBs
NCBI-ProteinID: ARX81725
UniProt: A0A1Z1W5M3
LinkDB
Position
complement(1169650..1171314)
AA seq 554 aa
MTQHLAAPAAPASGTRTDWWRDAVIYQVYPRSFADGNGDGMGDLEGVRARLPHLKDLGVD
AVWLSPFYASPQADAGYDVADYRAIDPMFGTLHDADAVIREAHALGLRIIVDLVPNHSSD
RHDWFRRALADGPGSPLRERYHFRPGKGQDGELPPNDWESIFGGPAWTRTIDPDGTPGDW
YLHLFAPEQPDFNWEHPAVRDEFRSILRFWLDMGVDGFRVDVAHGLVKAEGLPDIGRHDQ
LKLLGNDTMPFFDQDGVHEIYRSWRQVLSEYAGDRVLVAEAWTPTVERTAHYVRPDEMHQ
AFNFQYLGTHWDAAELREVIDSSLAAMRPVGAPATWVLSNHDVTRHATRFANPPGLGTQL
RTPGDRALGLRRARAATLLMLALPGSAYVYQGEELGLPDVTDLPDEARQDPSFHRAQGQD
GFRDGCRVPIPWTVDGPSYGFGTGGSWLPQPDGWGELSVQAQTGDPTSTLELYRAALRTR
RTQPGLGAGDDLEWTDAPAGVLAFRRAEFACTANTTGTPVRIAAPGRMLLASGPVEVTGG
EVELPADTTVWWAV
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgacccagcatctcgctgcccctgccgcccccgcctccggcacgcgtacggactggtgg
cgcgacgcggtgatctaccaggtctatccgcgcagcttcgccgacggcaacggcgacggc
atgggcgacctcgagggcgtccgggcccgtctgccgcacctgaaggacctcggcgtcgac
gccgtctggctcagccccttctacgcctcgccgcaggccgacgcgggctacgacgtcgcc
gactaccgcgccatcgacccgatgttcggcaccctccacgacgcggacgccgtgatcaga
gaagcgcacgccctgggcctgcgcatcatcgtggacctggtgcccaaccactcctccgac
cggcacgactggttccgccgtgccctcgccgacggccccggatcgcccctgcgggagcgt
taccacttccgccccggcaagggccaggacggcgaactgccgcccaacgactgggagtcc
atcttcggcggccccgcctggacccgcaccatcgaccccgacggcacccccggcgactgg
tacctccacctgttcgcccccgagcagcccgacttcaactgggaacaccccgccgtacgc
gacgagttccgctccatcctgcgcttctggctggacatgggcgtcgacggcttccgcgtg
gacgtcgcccacggcctggtcaaggccgagggactgcccgacatcggccggcacgaccag
ctgaagctgctcggtaacgacaccatgccgttcttcgatcaggacggcgtgcacgagatc
taccgcagctggcggcaggtgctctcggagtacgccggtgaccgcgtcctggtcgccgag
gcctggacgcccaccgtcgagcgcaccgcgcactacgtacgacccgacgagatgcaccag
gccttcaacttccagtacctgggcacccactgggacgccgccgagctgcgcgaggtcatc
gacagctcgctggccgcgatgcgccccgtcggcgcccccgccacctgggtcctgtccaac
cacgacgtgacccggcacgcgacccgcttcgccaacccgcccggcctcggcacccagctg
cgcaccccgggcgaccgcgccctcggcctgcgccgcgcccgcgccgccacgctgttgatg
ctggccctgcccggctccgcgtacgtctaccagggcgaggagctcggcctgcccgacgtc
accgacctgcccgacgaggcccgccaggacccctcgttccaccgggcgcaggggcaggac
gggttccgcgacggctgccgggtgccgatcccgtggaccgtcgacgggccgtcgtacggc
ttcggcacgggcggcagctggctgccgcagcccgacggctggggcgagctgagcgtccag
gcgcagaccggcgacccgacgtcgaccctggagctgtaccgcgcggccctgcggacccgt
cggacccagccgggtctcggcgccggcgacgacctggagtggaccgacgccccggcgggt
gtgctcgccttccggcgcgcggagttcgcgtgcaccgcgaacaccaccggtacgcccgtg
cggatcgccgcgcccggccggatgctgctcgcgagcggccccgtcgaggtgaccgggggc
gaggtggagctgcccgccgacaccaccgtctggtgggcggtgtga

DBGET integrated database retrieval system