KEGG   Streptomyces alboflavus: SMD44_01988Help
Entry
SMD44_01988       CDS       T05221                                 

Gene name
fucA
Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
salf  Streptomyces alboflavus
Pathway
salf00051  Fructose and mannose metabolism
salf01100  Metabolic pathways
salf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SMD44_01988 (fucA)
Enzymes [BR:salf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SMD44_01988 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ARX82575
UniProt: A0A1Z1W821
LinkDB All DBs
Position
complement(2140582..2141418)
Genome map
AA seq 278 aa AA seqDB search
MTEQRHDTTAGAGREALARAWDELVATARRTVTDGLVVGTSGNVSVRVGDTVLVTPSGVP
YDRLTPTDILGVGLDGERLLGTLGPTSELPMHLAIYRATDAGAVVHTHAVHATAVSTLVP
ELPPIHYMTGALGGPVRVAPYALYGTDELAEHMLHALRDRTACLLQNHGTVAYGDSLSQA
FDRTAQLEWMCHLWLTATSVPGRTPSILSAERVSEAGRKLKGYGQRGAGVDGSGGTDGSG
GVDGSAGVDGSGGVDRSAGTDGSGGANGTAGADRVDGG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcagcggcacgacaccactgcgggtgcggggcgcgaggcgctcgcgcgggcc
tgggacgagctggtcgcgaccgcccgcaggaccgtgacggacggcctggtcgtcggcacc
tccggcaacgtctccgtgcgcgtcggcgacaccgtcctcgtcaccccgagcggcgtcccc
tacgaccggctgacgcccacggacatcctcggcgtcggcctggacggcgagcggctcctc
ggcacgctcggccccaccagcgaactgcccatgcacctggcgatctaccgcgccaccgac
gccggggccgtcgtccacacccacgccgtgcacgccaccgccgtctccaccctggtcccg
gaactcccgcccatccactacatgaccggcgccctcggcggccccgtccgcgtcgccccg
tacgccctgtacggcaccgacgagctggccgagcacatgctccacgccctgcgcgaccgc
acggcctgcctgctccagaaccacggcacggtcgcctacggggactccctctcccaggcc
ttcgaccgcaccgcccaactggagtggatgtgccacctctggctcaccgcgacctcagtg
cccggccgcacgccgagcatcctgtccgcggaacgggtgagcgaggcggggcggaagctg
aaggggtacgggcagcggggggcgggggtggacgggtccggcgggacggacgggtctggt
ggggtggacgggtccgctggggtggacgggtccggcggcgtggacaggtctgctgggacg
gacgggtccggcggggcgaatgggaccgccggggcggacagggtggacgggggctga

DBGET integrated database retrieval system