KEGG   Streptomyces alboflavus: SMD44_02556Help
Entry
SMD44_02556       CDS       T05221                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
salf  Streptomyces alboflavus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ARX83142
UniProt: A0A1Z1W9S9
LinkDB All DBs
Position
complement(2771015..2772493)
Genome map
AA seq 492 aa AA seqDB search
MTELVEHGQLFIGGELVDPLGKDVIEVVSPHTGEVFARVPHAAPADVDRAVAVARKAFDE
GPWPRMTLDERIAVVERIKDGVGARHDEIARVISSENGTPYTASVMVQALSSMMVWDAAI
TTARGFTYEEARDGALGRILVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCPVILKT
SPEAPLDAYVLAEIAKEAGLPEGVLSILSADREVSEYLVAHPGVDKVSFTGSVAAGKRVM
EVCARNLTRVTLELGGKSAAVILPDADLAGAVAGIVPFAWMINGQACVAQTRILLPRSRY
DEFADAFAAAASALKVGDPMDPETELGPLVAERQQRRSLDYIRIGQEEGAKILAGGGRPA
GLDQGWYVEPTLFGSVDNSMRIAREEIFGPVICLLPYGDEDEAVRIADDSDYGLSGSVWT
ADVERGIDVARRVRTGTYSVNAFSLDMLGPFGGYKNSGLGREFGPEGYGEYFEHKMIHLP
PGYEPATDGGGA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgtggaacacggacagctgttcatcggcggggagttggtcgacccgctc
ggcaaggacgtcatcgaggtggtctcgccgcacacgggggaggtgttcgcgcgggtgccg
cacgccgcgcccgcggatgtcgaccgggccgtcgcggtggcgcggaaggccttcgacgag
gggccctggccgcgcatgacgttggacgagcggatcgcggtcgtcgagcggatcaaggac
ggggtcggggcgcggcacgacgagatcgcgcgggtcatcagctccgagaacggcactccg
tacaccgcctcggtgatggtgcaggcgctgtcgtcgatgatggtgtgggacgcggcgatc
accaccgcgcgcggcttcacgtacgaggaggcgcgggacggggcgctggggaggatcctg
gtgcggcgcgagcccgtcggggtcgtcgcggccgtggtcccctggaacgtccctcagttc
accgccgccgccaagctcgcgcccgcgctgctcgccgggtgcccggtgatcctgaagacc
tcgccggaggcgcccctcgacgcgtacgtactcgccgagatcgccaaagaggcgggcctg
cccgagggcgtgctctcgattctctcggccgaccgggaggtgagcgagtacctggtcgcg
cacccgggcgtcgacaaggtgtccttcaccggctccgtcgccgcgggcaagagggtgatg
gaggtctgcgcgcggaacctcacccgcgtcaccctggaactcggcggcaagtcggccgcc
gtgatcctgcccgacgccgacctcgcgggcgccgtcgccggcatcgtgcccttcgcctgg
atgatcaacggccaggcgtgcgtggcccagacccgcatcctgctcccgcgctcccgctac
gacgagttcgccgacgccttcgccgccgccgcgtccgccctgaaggtcggcgacccgatg
gaccccgagaccgagctgggcccgctggtcgccgagcgccagcagcgccgctccctcgac
tacatccggatcgggcaggaggagggcgccaagatcctcgccgggggcggccgtcccgcc
gggctcgaccagggctggtacgtggagccgacgctgttcggcagcgtcgacaactccatg
cgcatcgcccgcgaggagatcttcggccccgtcatctgcctgctcccgtacggcgacgag
gacgaggccgtacgcatcgccgacgactccgactacggcctgagcggcagcgtctggacc
gccgacgtcgagcgcggcatcgacgtggcgcgccgggtgcgcaccggcacgtactccgtg
aacgccttcagcctcgacatgctcggccccttcggcggctacaagaactccggcctcggg
cgggagttcggccccgagggctacggcgagtacttcgagcacaagatgatccacctgccg
ccggggtacgagcccgccaccgacgggggcggtgcctga

DBGET integrated database retrieval system