KEGG   Streptomyces alboflavus: SMD44_03484Help
Entry
SMD44_03484       CDS       T05221                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
salf  Streptomyces alboflavus
Pathway
salf00620  Pyruvate metabolism
salf00680  Methane metabolism
salf01100  Metabolic pathways
salf01120  Microbial metabolism in diverse environments
salf01200  Carbon metabolism
Module
salf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMD44_03484 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SMD44_03484 (ppc)
Enzymes [BR:salf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SMD44_03484 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARX84049
UniProt: A0A1Z1WCD5
LinkDB All DBs
Position
complement(3849507..3851336)
Genome map
AA seq 609 aa AA seqDB search
MRPGAPPGDQPRYKRLNAEEPYRLKATCVRQKLENTKQRLAKGTAHEPGRDYLGTAELLH
DLTLIQTSLRAHKGGLFSDGRMNRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPREYRQKLLAKELRSRRPLAPSPAPLDAAGEKTLGVFGTVKKALDVFGPEV
VESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELRAADVILDEML
ADPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDVVSDAAHSAYRRLVEDPDLPTYFLASTPVDQLADLH
LGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEMH
EHWHFFRNFVSNVEMTLAKTDLRIARHYVDSLVPDDLKHVFDTIEAEHALTVAEVLRVTG
GERLLDSNPVLQQTFSIRDAYLDPISYLQVALLKRQRDAVAAGDEADPLLARALLLTVNG
VAAGLRNTG
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacctggagcgcctcccggagatcagccccgctacaagcgcctcaacgccgaggag
ccctaccgcctcaaggccacctgcgtccggcagaagctggagaacaccaagcagcgcctg
gccaagggcaccgcgcacgagccgggccgcgactacctgggcaccgccgagctgctgcac
gacctcacgctcatccagacgtcgctgcgcgcccacaagggcggcctgttctccgacggc
cgcatgaaccgcaccatccgcaccctcgccgccttcggcctccagctcgccaccatggac
gtgcgcgagcacgccgacgcccaccaccacgccctcggccagctcttcgaccggctcggc
gaggagtcctggcggtacgccgacatgccgcgcgagtaccgccagaagctgctcgccaag
gagctgcgctcgcgccgcccgctcgcgccgtccccggcgccgctcgacgcggccggggag
aagacgctcggcgtgttcggcacggtcaagaaggccctggacgtgttcgggcccgaggtc
gtcgagtcgtacatcatctccatgtgccagggcgccgacgacgtgttcgccgccgccgtc
ctcgcccgcgaggccggactcatcgacctgcacgcgggctgggcgaagatcggcatcgtg
ccgctcctggagaccaccgacgagctgcgcgccgccgacgtcatcctggacgagatgctc
gccgacccgtcgtaccgcaggctggtcgcgctccgcggggacgtgcaggaggtcatgctc
gggtactccgactcctccaagttcggcggcatcaccacctcgcagtgggagatccaccgc
gcccagcgccgactgcgcgacgtcgcccaccgctacggggtgcggctgcggctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatcctcgcccag
ccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtacctggtgccgtccctggcccgggagaacctggaactgacggtcgccgccaccctc
caggcctccgccctgcacaccgcgccccgccagtccgacgaagccctggcccgctgggac
gccgccatggacgtcgtgtccgacgccgcgcactccgcgtaccgcaggctcgtcgaggac
ccggacctgccgacctacttcctcgcctccacccccgtcgaccagctcgccgacctgcac
ctgggctcccggccctcacggcgccccggctccggcgtctccctcgacggcctgcgcgcc
atcccgtgggtgttcggctggacccagtcacggcagatcgtgcccggctggttcggcgtg
ggctccggactcaaggcgctccgcgaagccggactcgacaccgtcctcgacgagatgcac
gagcactggcacttcttccggaacttcgtctccaacgtggagatgacgctcgccaagacc
gacctgcgcatcgcccggcactacgtggactcgctggtgcccgacgacctgaagcacgtc
ttcgacaccatcgaggccgagcacgcgctcacggtcgccgaggtcctgcgcgtcaccggc
ggcgagcgcctgctcgactccaacccggtgctccagcagaccttctcgatccgcgacgcc
tacctggacccgatctcctacctccaggtcgcgctgctcaagcggcagcgggacgcggtg
gccgcgggcgacgaggccgacccgctgctcgcacgggcgctgctgctcaccgtcaacggc
gtcgcggcggggctgcgcaacaccggctga

DBGET integrated database retrieval system