KEGG   Streptomyces alboflavus: SMD44_03602Help
Entry
SMD44_03602       CDS       T05221                                 

Definition
(GenBank) hypothetical protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
salf  Streptomyces alboflavus
Brite
KEGG Orthology (KO) [BR:salf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMD44_03602
Enzymes [BR:salf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SMD44_03602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ARX84165
UniProt: A0A1Z1WCI6
LinkDB All DBs
Position
3974499..3975383
Genome map
AA seq 294 aa AA seqDB search
MRIGSVTKTFTAVVVLQLVQEGRISLNDTVEKHLPNLLRGKGIDGNGITVRQLLQHTSGL
PDFEDDVTDDILERRYLSPRDALDIALRHEAVFKPGKKWRYSNTNYLVAGLMVEKITGRP
LAEQIDQRIIKRIGLRHTYFPAPGETTIRERHPQGYRQEPLNTPVRNVTKIDPSAAWAAG
AMVSTNSDLNRFFSALLKGKGNALLKSAQRKQMRTTVPMEEGNPRYGMGLGIMRVRVSDQ
CVVWGHSGGIPGYGTWAGATDDGRAASATMTLEPKTDEAVAHLEKTVTAALCRR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatcggcagtgtcaccaagacgttcaccgcggtggtcgtgctgcaactggtccaa
gagggccggatcagcctcaatgacacggtcgagaaacacctgccgaacctcctgcgcgga
aaggggatcgacgggaacggcattacggtgcgccagctcctgcagcacaccagcggactg
cccgacttcgaggacgacgtcaccgatgacatcctggagcgccgctacctctctccccgc
gacgccctggacatcgcccttcgacacgaagccgtcttcaagcccggcaagaagtggcgg
tacagcaacacgaactacctggtcgccgggctgatggtggagaagatcaccggacggccc
ctcgccgaacagatcgaccagcgcatcatcaagcgcatcgggctgcgccacacctacttc
cccgcccccggcgagacgaccatccgcgaacgccacccccagggctaccgccaggaaccc
ctgaacacgccggtgcgcaacgtcaccaagatcgatccctccgcggcctgggcggcaggt
gccatggtctccaccaactccgacctcaaccgcttcttctccgcgctgctcaagggcaag
ggcaacgctctcctcaagagtgcccagcgcaagcagatgcgcaccaccgtccccatggag
gaaggtaatccccgctacggcatggggctggggatcatgagggtgcgggtgtcggaccag
tgcgtcgtctggggccacagcggcggcatcccgggctacggcacttgggctggggccacc
gacgacggccgcgccgccagcgccacgatgaccctcgaaccgaagaccgacgaagccgta
gcgcacttggagaagacagtgacagcggccctgtgccgacgctga

DBGET integrated database retrieval system