KEGG   Streptomyces alboflavus: SMD44_05656Help
Entry
SMD44_05656       CDS       T05221                                 

Definition
(GenBank) serine protease
Organism
salf  Streptomyces alboflavus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Inhibitor_I9
Motif
Other DBs
NCBI-ProteinID: ARX86187
UniProt: A0A1Z1WIB2
LinkDB All DBs
Position
6141458..6143041
Genome map
AA seq 527 aa AA seqDB search
MAVMRHPRRRLAGTGTLALTAATAVALGVVAALPASAQPKAAEGRIQYADAPGSIANSYI
VTLDADAPKADSPAGKALAKKHGAEIERTYKKVLNGYEVQASEAEAKRFAADPAVASVVQ
NRTYTVSATQPNPPSWGLDRIDQRNLPLDQKYTYPDKAGEGATVYVIDTGVRKSHQDFGG
RAVDGYDAIDNDNVAQDGHGHGTHVAGTVGGTAHGVAKKAKIVGVRVLNNSGSGTTAQVV
AGIDWVTRNATKPAVANMSLGGPADSALDTAVRNSIAAGITYAVAAGNETTNASTRSPAR
VTEAITVGATTNTDAKANYSNFGTVLDLFAPGSGITSAWNTNDTATSTISGTSMASPHVA
GAAALYVAENPSATPAQVSTALTTAATPNVVGSPGTGSPNRLLYVGTGGTNPPGPKFENG
ADFAITDNSTVESPVTVTGVPGNAPSALSVPVAIKHTYVGDLKVELLAPDGSAYVLKDYG
VGGSSDDINTSYTVNASSETANGTWKLRVSDNAAQDIGTLDSWGLQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgcgtcacccccgccgaagactggccggtacgggcaccctcgccctcacc
gccgccaccgccgtcgccctcggtgtcgtcgccgcgctccccgcgagcgcgcagccgaag
gcagcggaaggccggatccagtacgcggacgctcccggctcgatcgccaacagctacatc
gtcaccctcgacgcggacgccccgaaggcggactcgcccgccggcaaggcgctcgcgaag
aagcacggcgccgagatcgagcggacgtacaagaaggtcctgaacggctacgaggtgcag
gcgtccgaggccgaggcgaagaggttcgccgccgacccggccgtcgcctccgtcgtgcag
aaccgcacgtacacggtctccgcgacccagcccaacccgccgtcgtggggtttggaccgc
atcgaccagcgcaacctcccgctggaccagaagtacacctacccggacaaggccggtgag
ggtgccaccgtctacgtcatcgacaccggagtccgcaaaagtcaccaggacttcggcggc
cgcgccgtcgacggctacgacgccatcgacaacgacaacgtcgcgcaggacggccacggc
cacggcacgcacgtcgccggaaccgtcggcggcaccgcgcacggcgtcgccaagaaggcc
aagatcgtcggcgtccgcgtgctcaacaactcgggctccggcaccaccgcccaggtcgtc
gcgggcatcgactgggtgacgcgcaacgccaccaagccggccgtcgccaacatgagcctc
ggcggcccggccgacagcgcgctcgacaccgccgtccgcaactccatagccgccggcatc
acctacgccgtcgccgcgggcaacgagaccaccaacgccagcacccgctcgcccgcacgc
gtcaccgaggccatcaccgtcggcgccaccaccaacaccgacgccaaggccaactactcc
aacttcggcacggtcctcgacctgttcgcccccggctccggcatcacgtcggcgtggaac
accaacgacacggcgaccagcacgatctccggtacgtcgatggcgtccccgcacgtcgcg
ggcgccgcggccctgtacgtcgcggagaacccgtcggccaccccggcgcaggtctccacg
gccctgacgaccgccgccacgccgaacgtcgtcggcagccccggcaccggctcgcccaac
cgcctgctgtacgtgggcacgggcggcaccaacccgcccggaccgaagttcgagaacggc
gcggacttcgcgatcaccgacaactccaccgtcgagtccccggtgaccgtcaccggtgtc
cccggcaacgccccctcggcgctcagcgtcccggtggccatcaagcacacctacgtcggt
gacctgaaggtcgaactcctcgcccccgacggctccgcctacgtcctcaaggactacgga
gtcggcggcagctcggacgacatcaacacctcgtacaccgtcaacgcctcctcggagacg
gccaacggcacctggaagctccgggtcagcgacaacgcggcccaggacatcggcaccctg
gactcctgggggctgcagttctga

DBGET integrated database retrieval system