KEGG   Streptomyces alboflavus: SMD44_05839Help
Entry
SMD44_05839       CDS       T05221                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
salf  Streptomyces alboflavus
Brite
KEGG Orthology (KO) [BR:salf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMD44_05839 (sodN)
Enzymes [BR:salf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMD44_05839 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N Cgr1
Motif
Other DBs
NCBI-ProteinID: ARX86368
UniProt: A0A1Z1WJ00
LinkDB All DBs
Position
complement(6347017..6347412)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKASAHCDLPCGVYDPAQARIEAESVKAVQEKMAANDDAHYQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHTLVNDTLKALSAAKASADPKTGEKALELIAE
IDRIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtgaaggccagcgcgcactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggagtcggtcaaggccgtgcaggag
aagatggccgccaacgacgacgcgcactaccaggctcgcgccaccgtcatcaaggagcag
cgcgccgagctcgccaagcaccacgtgtcggtgctctggagcgactatttcaagcccccg
cacttcgagaagtacccggagctgcacacgctggtcaacgacaccctcaaggcgctctcg
gccgcgaaggcgtcggcggacccgaagaccggtgagaaggccctcgagctgatcgccgag
atcgaccgcatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system