KEGG   Streptomyces alboflavus: SMD44_05890Help
Entry
SMD44_05890       CDS       T05221                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
salf  Streptomyces alboflavus
Pathway
salf03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:salf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SMD44_05890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:salf03400]
    SMD44_05890
Enzymes [BR:salf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SMD44_05890
DNA repair and recombination proteins [BR:salf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SMD44_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ARX86419
UniProt: A0A1Z1WJ78
LinkDB All DBs
Position
complement(6400055..6400954)
Genome map
AA seq 299 aa AA seqDB search
MTPITEVEGRRLALSNLDKVLYADSGFTKGEVLHYYATAAGALLPHLRDRPVSFLRFPDG
PDGQRFFAKNVPPGTPTWVRTAEVRRSDGVSRQIVVQDLATLMWAANLVTEFHTPQWRTD
APGLADRLVLDLDPGPPASVVEACEAALWLRERLVADGFAVYVKTSGSKGLHLLASLRPT
PSEDVTAYAKGLAVAAEQALPRLVVHRMTRALRPGKVFVDFSQNAAAKTTATPYTLRARA
EPTVSTPVTWAEVEACRERRDPGLLVFLATDVGARLERYGDLLGPLLDPERGGVLPPPG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccatcaccgaggtggaggggcgaaggctcgcgctcagcaatctcgacaaggtg
ctctacgcggacagcggcttcaccaagggcgaggtgctgcactactacgccaccgccgcg
ggggccctcctcccccacctgcgcgaccggcccgtgtccttcctgcgcttcccggacggg
cccgacgggcagcggttcttcgccaagaacgtgccgccgggtacgcccacctgggtgcgg
acggccgaggtgcggcggtcggacggggtctcacggcagatcgtcgtgcaggacctggcg
acgctgatgtgggcggcgaacctggtcaccgagttccacacgccgcagtggcggacggac
gcgcccgggctcgccgaccggctcgtgctcgacctcgacccggggccgcccgcgagcgtc
gtggaggcctgcgaggcggcgctgtggctgcgggagcggctggtggccgacgggttcgcc
gtgtacgtcaagacgtcgggcagcaaggggctgcacctgctggcgtcgctgcggccgacg
cccagtgaggacgtcacggcgtacgcgaagggtcttgccgtggccgccgagcaggcgctg
ccgcggcttgtggtgcaccggatgacgcgcgccctgcggccggggaaggtgttcgtcgac
ttcagccagaacgcggcggcgaagaccacggcgacgccctacaccctgcgggcgcgggcc
gagccgaccgtgtccacgccggtgacctgggccgaggtggaggcgtgccgggagcggcgg
gatccggggctgctggtgttcctggcgaccgatgtcggggcgcggctcgagcggtacggg
gatctgctcggaccgctgttggacccggagcggggcggggtgctgccgccgccggggtga

DBGET integrated database retrieval system