KEGG   Streptomyces alboflavus: SMD44_06200Help
Entry
SMD44_06200       CDS       T05221                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
salf  Streptomyces alboflavus
Pathway
salf00473  D-Alanine metabolism
salf00550  Peptidoglycan biosynthesis
salf01100  Metabolic pathways
salf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SMD44_06200 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMD44_06200 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SMD44_06200 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:salf01011]
    SMD44_06200 (ddl)
Enzymes [BR:salf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SMD44_06200 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:salf01011]
 Precursor biosynthesis
  Amino acid ligase
   SMD44_06200 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ARX86723
UniProt: A0A1Z1WJV1
LinkDB All DBs
Position
6747980..6749125
Genome map
AA seq 381 aa AA seqDB search
MSSENLPQSPRKPRVAVVFGGRSSEHGISVVTAGAVLRAIDRTKYDVLPIGITTDGRWAL
TADDPDRMAIADRKVPSVAELADSDGGGVVLPVDPGNREVVYSEPGAVPKALGEVDVVFP
MLHGPYGEDGTLQGLLELSGVPYVGAGVLASAVGQDKEYMKRVFTSFGLPVGPYLVIRPR
EWQREEKKARQRVADFAGEHGWPLFIKPARAGSSIGITKVDSFDGLDEAIAEAQRHDPKI
IVEALLRGREIECGVLEFEDGPRASVPAEIPPVQAHDYYDFEAKYIDSTPGLVPAPLTPE
ETAEVQRLAVEAFEAASCEGLVRADFFLTEDGRFVINEINTMPGFTPISMYPQMWEKSGV
GYAELVDRLIQAALSRSTGLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgagaacctcccccagagcccccgcaagccgcgtgtggccgtcgtgttcggc
ggccgcagctcggagcacggcatctccgtcgtcaccgccggtgccgtactgcgcgccatc
gaccggaccaagtacgacgtgctgccgatcggcatcaccacggacgggcgctgggcgctg
accgcggacgaccccgaccggatggccatcgccgaccgcaaggtgccgagcgtcgccgag
ctcgccgactccgacggcggcggcgtcgtcctgcccgtcgacccgggcaaccgcgaggtc
gtctacagcgagcccggcgcggtgcccaaggcgctcggcgaggtcgacgtggtcttcccg
atgctgcacggcccctacggcgaggacggcaccctccagggcctcctggagctgtccggc
gtgccgtacgtgggcgcgggcgtgctcgcctcggccgtcggccaggacaaggagtacatg
aagcgggtcttcacctccttcgggctgcccgtcggcccgtacctggtgatccggccccgc
gagtggcagcgcgaggagaagaaggcccggcagcgcgtcgcggacttcgcgggcgagcac
ggctggccgctgttcatcaagcccgcgcgcgcgggctcctcgatcggcatcaccaaggtc
gactccttcgatggcctcgacgaggccatcgcggaggcgcagcgccacgacccgaagatc
atcgtggaggcgctcctgcgcggccgcgagatcgagtgcggcgtcctggagttcgaggac
ggcccgcgcgccagcgtgcccgccgagatcccgccggtgcaggcgcacgactactacgac
ttcgaggcgaagtacatcgactcgacgcccggcctggtccccgccccgctgacgccggag
gagaccgccgaggtgcagcggctcgccgtcgaggccttcgaggcggcgtcctgcgagggc
ctggtgcgcgcggacttcttcctcaccgaggacggccggttcgtcatcaacgagatcaac
acgatgccgggcttcacgccgatctccatgtacccgcagatgtgggagaagagcggcgtc
gggtacgcggagctggtggaccgcctcatccaggcggcgctctcccggtccacgggcctg
cggtag

DBGET integrated database retrieval system