KEGG   Streptomyces alboflavus: SMD44_06740Help
Entry
SMD44_06740       CDS       T05221                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
salf  Streptomyces alboflavus
Brite
KEGG Orthology (KO) [BR:salf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SMD44_06740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ARX87259
UniProt: A0A1Z1WLK0
LinkDB All DBs
Position
7392990..7393538
Genome map
AA seq 182 aa AA seqDB search
MHQAKETPGRPHGRWKRARALYRNVSKRRTAWLLLKDTVNSCIEYRVLGLAAEAAFFTLL
SVPPLLLSLIGLLAYVDRWTGADTITSVENNILEASRTILSDKGVREIAQPILEDVMKVG
RPDVISIGFLFALWSGSRAVNVFIDTITVMYGLDGARGIVKTRILAFGSSSSPSSSGPSR
CR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccaggcaaaagaaacacccgggcggccacacggtcgctggaaacgggcccgcgct
ctctaccgcaacgtctccaagcgcaggaccgcctggctgctgctgaaggacaccgtcaac
tcctgcatcgagtaccgcgtcctcgggctcgcggcggaggcggcgttcttcacgctgctg
tccgtgccgccgctgctgctcagcctcatcgggctgctcgcgtacgtcgaccggtggacc
ggcgcggacaccatcaccagcgtcgagaacaacatcctcgaagcgtcccggacgatcctc
tccgacaagggcgtccgcgagatcgcgcagccgatcctcgaggacgtgatgaaggtcggg
cggcccgacgtcatctccatagggttcctcttcgccctctggtcgggatcgcgcgccgtc
aacgtcttcatcgacaccatcaccgtcatgtacggactcgacggcgcccgcggcatcgtc
aagacccggatcctcgccttcggctcttcctcgtcgccctcgtcatcgggtccgtcgcgc
tgccgctga

DBGET integrated database retrieval system