KEGG   Streptomyces alboflavus: SMD44_06976Help
Entry
SMD44_06976       CDS       T05221                                 

Gene name
puuE
Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
salf  Streptomyces alboflavus
Pathway
salf00250  Alanine, aspartate and glutamate metabolism
salf00410  beta-Alanine metabolism
salf00640  Propanoate metabolism
salf00650  Butanoate metabolism
salf01100  Metabolic pathways
salf01120  Microbial metabolism in diverse environments
Module
salf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SMD44_06976 (puuE)
   00650 Butanoate metabolism
    SMD44_06976 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMD44_06976 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMD44_06976 (puuE)
Enzymes [BR:salf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SMD44_06976 (puuE)
Amino acid related enzymes [BR:salf01007]
 Aminotransferase (transaminase)
  Class III
   SMD44_06976 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ARX87495
UniProt: A0A1Z1WM32
LinkDB All DBs
Position
7632965..7634248
Genome map
AA seq 427 aa AA seqDB search
MKDLYARHRAVLPDWLALYYDEPIELTHGEGRHVWDAAGRRYLDFFGGILTTMTAHALPD
VTKAVAEQAGRIIHSSTLYLNRPMVDLAERIAALSGIPDARVFFTTSGTEANDTALLLAT
AHRRSNQILAMRNSYHGRSFTAVGITGNQSWSPTSLSPLQTLYVHGGVRSRGPYAALDDA
EFTAACVADLRDMLGQSRGGVAALIAEPIQGVGGFTSPPDGLYAAFREVLAEHGILWIAD
EVQTGWGRTGDHFWGWQAHAAAGPPDLLTFAKGIGNGMSIGGVVGRAEIMNSLDANSIST
FGGSPVTMAAGLANLSYLLEHDLQGNARRVGGLLIERLRAICAQLPVVREVRGRGLMIGI
ELVGPGTDEAHPQAAAAVLEAAREGGLLIGKGGGHSTSVLRIAPPLSLTVAEAEEGAAIL
ERALRSV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacctctacgcacggcaccgggccgtcctgccggactggctcgcgctctactac
gacgagccgatcgagctgacgcacggcgagggccgccacgtctgggacgccgccggacgg
cgctacctcgacttcttcggcggcatcctcaccaccatgaccgcgcacgcgctgcccgac
gtcaccaaggccgtcgccgagcaggcgggccggatcatccacagctccacgctctatctg
aaccgcccgatggtcgacctggccgagcggatcgcggccctgtccggcatcccggacgcc
cgcgtgttcttcacgacgtcgggcaccgaggccaacgacacggcgctgctcctcgccacc
gcccaccgccgctccaaccagatcctggcgatgcgcaacagctaccacggccgctccttc
accgcggtcggcatcaccggcaatcagtcctggtcgcccacgagcctgtcgccgttgcag
acgctgtacgtccacggcggcgtccgctcccgcggcccctatgccgccctggacgacgcc
gagttcaccgcggcgtgcgtcgcggacctgcgggacatgctcggccagtcccgcggcggc
gtcgccgcgctcatcgccgagccgatccagggcgtcggcggcttcacctcgccgcccgac
ggcctgtacgccgccttccgcgaggtcctcgccgagcacggcatcctgtggatcgccgac
gaggtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcgcacgcc
gccgccggaccgccggacctgctcaccttcgccaagggcatcggcaacggcatgtccatc
ggcggcgtcgtcggccgcgccgagatcatgaactccctggacgccaactccatctccacc
ttcggcggctcgcccgtcaccatggccgcgggcctcgccaacctctcgtacctcctggag
cacgacctccagggcaacgcgcgccgcgtcggcgggctgctcatcgaacgcctgcgggcc
atctgcgcccagctccccgtggtccgcgaggtgcgcggccggggcctgatgatcggtatc
gagctggtcgggcccggcaccgacgaggcccacccgcaggcggccgcggccgtcctggag
gcggcccgtgagggcggtctgctcatcggcaagggcggcgggcacagcaccagcgtgctg
cgcatcgccccgcccctgtcgctgaccgtcgccgaggccgaggagggcgccgcgatcctg
gagcgggccctgcggagcgtctag

DBGET integrated database retrieval system