KEGG   Streptomyces alboflavus: SMD44_07241Help
Entry
SMD44_07241       CDS       T05221                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
salf  Streptomyces alboflavus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase HTH_53
Motif
Other DBs
NCBI-ProteinID: ARX87759
UniProt: A0A1Z1WMZ2
LinkDB All DBs
Position
complement(7915436..7916494)
Genome map
AA seq 352 aa AA seqDB search
MPPVKPMLAKSVARIPPGMQYEAKWDGFRAVVFRDGPEIEIGSRGTKSLTRYFPELVEAL
RERLPERCVVDGEIVIARGGRLEFDALTERIHPAESRVRLLAERTPASFVAFDLLALFDE
SLLDVSLSDRRALLTRALEGVSAPVHLAPATLDREVAERWFEEFEGAGLDGVIAKPLDLR
YRQNERLMYKIKHERTADCVVAGFRFHKSGPVVGSLLLGLYDDGGTLQHVGVCAAFAMKR
RAELMAELEPLRMESVAGHPWAAWTEEAAHEGARLPGAVSRWTGKKDLSWVPLRPERVCE
VAYDHMENGARFRHTAQFRAWRLDRDPGSCTYAQLEEPAGYDLTEVLGSPPA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtgaagcccatgctcgccaagtccgtggcgcggattccgcccgggatgcag
tacgaggcgaagtgggacgggttccgggccgtcgtcttccgggacggcccggagatcgag
atcggcagccggggcacgaagtccctgacccggtactttcccgagctggtcgaggcgctg
cgggaacgccttccggagcggtgcgtggtcgacggggagatcgtcatcgcgcgcgggggg
cggctcgaattcgacgccctcaccgaacgcatccatccggcggagtcccgggtacggctg
ctcgccgagcgcacaccggcgtccttcgtcgccttcgatctgctcgccctcttcgacgag
tccctgctcgacgtctccctcagcgaccggcgcgcgcttctgaccagggcgcttgagggt
gtgagcgcgcccgtgcacctggctcccgccacgctcgaccgggaggtggccgagcggtgg
ttcgaggagttcgagggcgccgggctcgacggggtcatcgccaagccgctcgacctgcgg
taccggcagaacgaacgcctcatgtacaagatcaagcacgagcggaccgcggactgcgtc
gtcgcgggcttccgcttccacaagagcgggcccgtggtcgggtcgctgctgctcggcctg
tacgacgacggggggacgttgcagcacgtcggggtgtgcgcggccttcgccatgaagcgg
cgggccgagctgatggccgagctcgaaccgctgcggatggagtccgtggcggggcatccg
tgggcggcgtggaccgaggaggccgcccacgagggggcgcggctgccgggggcggtgagc
cggtggaccggcaagaaggatctgtcgtgggtgccgttgcggccggagcgggtgtgtgag
gtggcctacgaccacatggagaacggggcgcggttccggcacaccgcgcagtttcgggcg
tggcgccttgaccgggatcccggctcctgtacgtacgcccagctggaggagcccgccggg
tacgacctgaccgaggtcctcgggtcgcccccggcgtag

DBGET integrated database retrieval system