KEGG   Shewanella algae: BS332_02640Help
Entry
BS332_02640       CDS       T05622                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
salg  Shewanella algae
Brite
KEGG Orthology (KO) [BR:salg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BS332_02640
Enzymes [BR:salg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BS332_02640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AXQ16488
LinkDB All DBs
Position
complement(558906..560156)
Genome map
AA seq 416 aa AA seqDB search
MCLGARPFVDKVAVSAKGFWAYLPIYASILVSVSLLSACNSDSQEVVLNPVDTAKMQQTV
EQLAKEMLVPGAVVILRTPRGDFKTAYGVTRYGGSEATDFDQHVRVGSNTKTWVGTVILQ
MAQQGRLQLSDTVSMYLDNVPNGESITIEHLLTMRSGLFNYSTTLELNQTLDEQPTKVWT
QAELLAMSFAHKPGFAPGSAFEYSNTNTVLLGLIAEQIDGKPLAAVMQQRLFAPLGLERT
LFPDIHSNTLPAPLARGYMYGTNVLTMDPPFKLPEKMQREAREGILAPIDQTEANPSWGW
AAGAGISSANELATWVEALVAGELLDADWQRRRLDSVRPIDPDNSNTAYYGLGIAKFGSL
YGHTGELPGYNSFMGHDPVNKVTLVVWTNLAPAVDGKDPATTIAAALINMLYIPSS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcttgggagccagaccctttgtcgataaggtggccgtcagtgccaaggggttttgg
gcttatctgcctatctatgcgtctatcttggtctctgtgagtttgctgagcgcctgcaat
tcggattcacaagaagtggtgctcaatcctgtcgacacggccaagatgcagcagacggtg
gaacaactggccaaggagatgctggttcccggcgccgtggtgattctgcgaacgcctagg
ggcgactttaaaaccgcctatggggtaacccgttatggcggcagtgaagcgaccgacttt
gatcagcatgtcagggtgggctccaataccaagacctgggtcggtaccgtgattttgcag
atggcgcagcaagggcgactgcaactgagtgacactgtctccatgtatctcgacaatgtg
ccaaacggtgagtcgatcaccatagagcatttgcttactatgcgtagcggcctgttcaat
tacagcaccacgctcgagttgaatcagacacttgatgagcagccaaccaaggtgtggact
caggctgagctgctggcaatgagttttgcccataagccaggttttgcccccggcagcgca
tttgaatactccaataccaataccgtcttgctgggactgatcgccgagcaaatcgatggc
aagccgctggcggctgtgatgcagcagaggttgtttgcccccttgggtcttgagcggact
ctgtttcccgatatccattctaatactcttcccgcgcccttggcgcggggttatatgtat
ggcaccaatgtgttgactatggatccgccctttaagctgcccgaaaagatgcagcgagaa
gccagagagggcattctggcacccatagatcaaaccgaggccaatccttcctggggctgg
gcggccggcgccgggatctccagtgccaatgagttggcaacctgggtagaagctttggtt
gccggagaactgctggatgccgattggcagcgaaggcgtctggatagtgtcaggccgata
gatcccgataattccaacacggcctattatggtctggggatcgccaagtttggcagcctc
tatggtcatactggtgagctgcccggctataactcctttatgggacatgatcctgtcaac
aaggtgactctggtggtttggaccaacctggcaccggcggtggatggcaaagatccggct
accaccatagcggcggccctaattaacatgctctatattccatccagttag

DBGET integrated database retrieval system