KEGG   Shewanella algae: BS332_03210Help
Entry
BS332_03210       CDS       T05622                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
salg  Shewanella algae
Brite
KEGG Orthology (KO) [BR:salg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BS332_03210
Enzymes [BR:salg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BS332_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like NAD_binding_7 Glutaredoxin Thioredoxin_9 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AXQ13486
LinkDB All DBs
Position
complement(699699..701258)
Genome map
AA seq 519 aa AA seqDB search
MLDANLKNQLQTYLQNLKQPVELVVSADESPKSKELLALAQDIASLSSLVSVTEQSLSRT
PAMQVTSIKGSDIRFAGLPMGHEFTSLVLALLHTGGHPIKLEAELIEQIRSLPGEYHFET
FVSLSCQNCPDVVQALNMMAAINPRISNTMIDGALFQDEVEQRNIMAVPSVYLNGEPFSA
GRISLKEILNKLDTNASARQAESLNQRKPYEVLVVGAGPAGASAAIYAARKGLRTGLLAD
KFGGQVSETVGIENFISVKATEGPKLVANLEEHVRDYEVDVMDNQKAVRLGSNGLYEVEL
ENGAVLKSRTVLLATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIGGGNSG
IEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAKSMGNITIITQAQTTEVLGDGSRVIGL
NYTDRASGEQHNIALAGIFVQIGLVPNTEWLRGTVELTQRGEIIVDERGQTSLPGVFAAG
DVTNSAYKQIIIAMGSGATASLGAFDYLIRHSEDESAAA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgcgaatctgaaaaatcaactgcaaacctatctgcagaacctcaagcaacca
gttgaacttgtcgtatctgcagatgaaagcccaaagtccaaagagctgttggctctggca
caggatattgcctcgctgtcttccctggtcagtgtgaccgagcagtcactgtcccgtacc
ccggcgatgcaggttacctcaatcaagggctctgacatacgctttgccggtttgcccatg
gggcacgaatttacctcacttgtgttggctctgctgcacacaggtgggcatcccatcaag
ctggaggccgagctgatcgagcagatccgcagcctgccaggggaatatcattttgaaact
tttgtttctctgagctgccagaactgcccggatgtggtgcaggcgctcaatatgatggcg
gcgatcaacccacggatcagcaataccatgatagatggtgccctgttccaggatgaggtt
gagcagcgtaacatcatggccgtgccttcggtttatctgaacggcgagcctttctctgcc
ggccgcatcagcctgaaagagatactcaataaactggataccaatgcctctgcccgccaa
gccgagagcctcaaccagcgtaagccctacgaagtactggtggttggcgccgggcctgcc
ggtgcatcagccgccatctacgcagcccgtaagggactgcgcactgggctgttggccgac
aagtttggtggccaggtcagcgaaaccgtcggcattgaaaactttatttcggtcaaggcg
actgaaggccccaagttggtggcaaatctggaagagcatgttcgcgactatgaagtggat
gtgatggataaccagaaggcggttcgtcttggcagcaatggcctctatgaagtggaactg
gaaaatggtgccgtactcaagagccgtacagtcctgttggccacaggggctcgctggcgg
gaaatgaatgttcccggtgagcaggaatatcgtggccgcggtgtggcttattgccctcac
tgtgatggcccgctgttcaagggtaaacgggttgcggtgatcggcggtggtaactcgggt
attgaggcggctatcgatctggccaacatagtcgagcatgtgactgtactcgagtttgac
agcaaattgcgcgccgatgacgtgctgcagcgcaaggctaaatctatgggtaacatcacc
atcatcacccaggcgcaaacgacagaagtccttggtgatggcagtcgggttatcgggctc
aattacacagacagagccagtggcgagcagcataatattgcgctggcaggtatttttgtg
cagataggtctggtgcccaacactgaatggctgcgcggcactgtggagttgactcagcgc
ggtgagatcattgtcgatgaacgcggtcagacttcactgccaggggtgtttgccgccggt
gacgtgaccaactcggcctacaagcagattatcatcgccatgggtagcggtgcaaccgcc
tctctgggagcctttgactacctgatccgccattcagaggatgaatcggcagcggcttga

DBGET integrated database retrieval system