KEGG   Shewanella algae: BS332_07200Help
Entry
BS332_07200       CDS       T05622                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
salg  Shewanella algae
Pathway
salg00071  Fatty acid degradation
salg00280  Valine, leucine and isoleucine degradation
salg00281  Geraniol degradation
salg00310  Lysine degradation
salg00362  Benzoate degradation
salg00380  Tryptophan metabolism
salg00410  beta-Alanine metabolism
salg00640  Propanoate metabolism
salg00650  Butanoate metabolism
salg00903  Limonene and pinene degradation
salg00930  Caprolactam degradation
salg01100  Metabolic pathways
salg01110  Biosynthesis of secondary metabolites
salg01120  Microbial metabolism in diverse environments
salg01130  Biosynthesis of antibiotics
salg01200  Carbon metabolism
salg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:salg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BS332_07200
   00650 Butanoate metabolism
    BS332_07200
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BS332_07200
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BS332_07200
   00310 Lysine degradation
    BS332_07200
   00380 Tryptophan metabolism
    BS332_07200
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BS332_07200
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BS332_07200
   00281 Geraniol degradation
    BS332_07200
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BS332_07200
   00930 Caprolactam degradation
    BS332_07200
Enzymes [BR:salg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BS332_07200
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BS332_07200
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BS332_07200
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     BS332_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AXQ14119
LinkDB All DBs
Position
1578509..1580659
Genome map
AA seq 716 aa AA seqDB search
MIYQNSMIQVELLENNIARLCFNAEGSVNKFDRATLTSLDEALDAIKAEASVKALLLTSA
KDAFIVGADITEFLGLFAQEDEVLLSWLQQANAVFNKLEDMPFPTASAINGFALGGGCET
ILATDFRIADTSARIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEAALK
VGAVDAVVAPEQLQAAALQMLQDALAGKLDWQSRRQRKQSPLTLPKLEAMMSFTTAKGMV
FSVAGKHYPAPMAAVNVVEKAAGLGREEALLVEHQAFIQLAKTDVAKALIGIFLNDQLVK
GKAKKAAKQAKNIEQAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQKALDLGLNEAAKLL
TAQVERGRSTPAKMAKVLNNITPSLDYSAVKDANIVVEAVVEHPKVKATVLAEVEQQLAA
DAIIASNTSTISINLLAKSLKDPSRFCGMHFFNPVHKMPLVEVIRGEHSSEETISSVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLADGADFIAVDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKTGKDAIDIMFGHERLGQKNGKGFYQYSVDKRGKP
KKDKDPVSYELLQTEFGELKEFSSDEIIARTMIPMIIETVRCLEEGIVATPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVVLADKYAHLGGLYQVTDGMRELAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaaattcgatgattcaggttgagttactcgagaataatatcgcccgcctt
tgcttcaatgccgaaggatcggtaaacaaattcgaccgcgccaccctgacctctctggat
gaggcactggacgccatcaaagcagaagccagcgttaaggcactgctgctgacatcggcc
aaagatgcctttattgtcggtgccgacattactgagttccttgggttgttcgcccaggaa
gatgaagtactcttgtcatggttgcagcaagccaatgcggtattcaacaagctggaagac
atgcctttcccaactgcttctgctatcaatggttttgccctgggcggtggttgcgaaacc
attttggccacagacttccgcattgccgacaccagtgcccgaatcggcctgccggaaacc
aagctggggatcatcccgggattcggtggcacagtgcgcctacccagagtgataggtgca
gacaatgcactggagtggatcaccacaggcaaagaccaacgcccggaagccgctctcaaa
gtcggcgcagtagatgccgtcgtggctccagagcagctccaggccgcagcactacagatg
ctacaggacgcgctggctggcaaacttgactggcagagccgccgtcaacgtaaacagtcg
ccactgacactgcccaagctggaagctatgatgtcgttcaccacagccaagggcatggtg
ttttccgttgccggcaagcactatccagcgccaatggcggcggttaacgttgtggaaaag
gcagccggtctggggcgcgaagaagccttattggtagaacatcaagcctttattcaactg
gccaaaacagatgtggccaaggcgctgatcggcatcttcctcaatgaccaactggtcaaa
ggcaaagccaagaaggccgccaaacaagccaagaacattgaacaagccgcggtattgggc
gcaggcattatgggcggcggtatcgcctaccaaagtgccagcaagggtacgccgattgtt
atgaaggacatagcgcagaaggcgctggatctcggccttaacgaagcagccaagctactg
acggcccaggtagagcgtggtcgctccaccccggccaagatggccaaagtgctcaacaac
atcaccccatcgctcgactacagcgccgtcaaagacgccaacatagtagtagaagcggta
gtagaacatcccaaggttaaggcgactgtgctggccgaagtagagcagcagctggctgcc
gatgccatcatagcgtccaacacctcaaccatctcgattaacctgcttgccaagagtctg
aaagacccttcccgcttctgcggtatgcacttcttcaaccccgtgcacaagatgccactg
gtggaagtgatccgtggcgaacatagctcggaagaaaccatctcctctgtagtggcctat
gccagcaagatgggtaagacgccgatagtggtcaacgactgccccggcttcttcgttaac
cgggtactcttcccctatttcgccggttttaacggcctgctggccgatggtgcagacttt
atcgccgtcgacaaggtgatggagaaacagtttggttggcctatgggcccggcttatctg
ctagatgtagtcggtttggataccggccatcacgcccaggccgtcatggccgaaggcttc
ccggaccgtatgggcaaaacaggtaaagacgccatagatatcatgtttggccatgagcgc
ctggggcagaagaacggtaaaggtttctaccagtattctgtggataagcgtggtaagccg
aagaaagacaaggatcctgtcagctacgaattactgcagaccgaattcggtgaactcaaa
gagttcagcagcgatgaaatcatcgcccgcaccatgatccccatgattattgaaaccgta
cgctgcttggaagaaggcatagtcgccaccccggccgaagccgacatgggtctggtatat
ggtcttggcttcccaccattcagaggcggtgtgttccgctatctggataccatgggcgtt
gccaactttgtcgtcctggctgacaaatacgcccacctggggggactctaccaggtgacc
gatggcatgcgtgaactggcagccaacaacggttcttactatcaggcctaa

DBGET integrated database retrieval system