KEGG   Shewanella algae: BS332_08470
Entry
BS332_08470       CDS       T05622                                 

Definition
(GenBank) hypothetical protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
salg  Shewanella algae
Pathway
salg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:salg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BS332_08470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salg01001]
    BS332_08470
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:salg02022]
    BS332_08470
Enzymes [BR:salg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BS332_08470
Protein kinases [BR:salg01001]
 Histidine kinases
  OmpR family
   BS332_08470
Two-component system [BR:salg02022]
 OmpR family
  RstB-RstA
   BS332_08470
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3 UPF0242
Other DBs
NCBI-ProteinID: AXQ14319
LinkDB
Position
complement(1846160..1847467)
AA seq 435 aa
MKRLFIFSYLVLVFLFFTSIIFVFQLDFFSSDEWESDYLDRTNMSLSQLLSEISAAKGVA
SAEASLEQVLGNVHKQLRVISLDSAELSAEEKQILRDNRHYVKDMEEDISYIMFQGSDKV
YAISRDESAPFWQEYYFKESVALWVLFPVLAFINFVLLYLLARRLRRLERVHSAFANGDF
KVRAKTGVWHKVGHLNQSFNQMADKIAKLIDSNKQLTNAVAHEVRTPIFRIRCNLDMLDD
SGVRPEQMSYLEGIHQDLDELGTMVDELLQYARMERRQAPLQLSCQSLDTALQELIAHLQ
FETDIALELTKVEPLEAMVDLRLWHRAVSNIIRNGYRYASQSVSIRLSGDTDRIWLHIAN
DGPGIQDEDKQRIFDPFVRIDKSRDRGSGGHGLGLAISAQIIRQHCGDISVSDTASGGPS
FDIWLPRPATSCQNR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaagcgcctatttatcttctcctatctggtgctggtgtttctgtttttcacctccatc
atttttgtctttcagctggacttcttttcctccgatgagtgggaaagcgactatctggat
cgcaccaatatgtcactgagccagctgttgtctgaaatctcggccgccaagggtgttgcc
agcgctgaggcctcgcttgagcaggtgctaggcaacgtgcacaaacaactgagggtcatc
tctttggactcggccgagctgtcggctgaagaaaaacagatcctgagagacaaccggcat
tacgtcaaagacatggaagaggatatctcctatatcatgttccagggttcagataaggtg
tatgccatcagccgcgacgagtccgctcctttctggcaggaatactatttcaaagaatcc
gttgccctctgggtgctgtttcccgtgttggcttttatcaactttgtactactctacctg
ttggcccggcgtctgcgccgcttggaaagggttcacagtgcctttgccaatggagatttc
aaagtacgggccaagacaggtgtttggcacaaggtgggacacctgaaccagtcattcaat
caaatggctgacaagatagccaaactcatcgacagcaacaaacaactcaccaatgccgtt
gcccatgaagtgcgtacacctatattcaggatccgttgcaatctggacatgctggacgat
tccggcgtgcgcccggagcaaatgtcttatctggaaggcatacatcaggacctggatgaa
ctcggcaccatggtggacgagttgctgcaatacgccagaatggagcgacgtcaggcgcca
ttacaattgagctgccaatcattggataccgcgctgcaggagttgattgcccacctgcag
tttgaaaccgatatcgcccttgaactcaccaaggtagaaccactggaggccatggtagat
ctgcgcctctggcatagagctgtcagcaatatcatccgcaacggctaccgctatgccagc
caaagcgtcagcataaggctcagcggcgacactgacaggatctggctgcatattgccaac
gatggcccagggatccaggatgaagataaacaacgcatttttgaccccttcgttcgcata
gacaaatcacgggatcgcggcagcggcggtcacggcctggggctggccatcagtgcccag
atcattcgccagcactgtggggacattagcgtcagcgacacagcaagcggtggcccgagt
ttcgatatctggttacccagaccggcaacaagctgccaaaacagataa

DBGET integrated database retrieval system