KEGG   Shewanella algae: BS332_15480Help
Entry
BS332_15480       CDS       T05622                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
salg  Shewanella algae
Pathway
salg00250  Alanine, aspartate and glutamate metabolism
salg00410  beta-Alanine metabolism
salg00430  Taurine and hypotaurine metabolism
salg00650  Butanoate metabolism
salg01100  Metabolic pathways
salg01110  Biosynthesis of secondary metabolites
salg01120  Microbial metabolism in diverse environments
salg02024  Quorum sensing
Module
salg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BS332_15480
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BS332_15480
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BS332_15480
   00430 Taurine and hypotaurine metabolism
    BS332_15480
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BS332_15480
Enzymes [BR:salg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BS332_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXQ15465
LinkDB All DBs
Position
complement(3405834..3407480)
Genome map
AA seq 548 aa AA seqDB search
MTASKQRQATASENSLMRIFTVPEAPESTLSRIEQALSQDLAGFLTQNIAALEKPLSEIE
KDFQAFEIPRQPRFVSDYTEEMMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYGETTDFYHRWMHSANHALGAFCSGGTVANIT
ALWIARNQLLKADGQFRGINREGLGAALCHYGWKGLAILVSERGHYSLGKAADLLGIGRD
NIVSIATDANNKVDIDAMREAATKLARQGIRVMAIIGVAGTTETGNIDPLPELAELATEL
NCHFHVDAAWGGASLLSSKYRHLLKGIELADSVAIDAHKQMYVPMGAGMVLFKQPELARA
IVHHAEYILRKGSKDLGSQTLEGSRPGMAMLVHACMQIIGKEGYEILINNSLEKARFFAG
LIEQHSEFELVSAPELCLLTYRWCPSWAQTALNRQLAQGNLEKVKEINGILDDLTRAIQK
KQREQGKSFVSRTRIQPARYHRETVTVFRVVLANPLTTDTILADVLNEQTELAASETGLL
QVLKQACN
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcaagcaacgccaggccaccgcctcagaaaactctctgatgcgtatcttt
accgtgcccgaagcaccggaatcgaccctgagccgcatagagcaggcattgtctcaagat
ctcgccggtttcctgacccagaatatcgccgcgctggaaaagcccctgagtgaaatcgaa
aaggatttccaggcctttgaaatcccgcgtcaacccagatttgtttctgactacacagaa
gagatgatgcagaatttggtggcgcattcagtacacaccgccgcccccagctttatcggc
catatgacatcggcgctgccctacttcgtgttgcccttgtcgaaaatgatggtgggcctg
aatcagaatctggtcaaaatcgaaacctccaaggccttcactcccttggagcggcaggtg
ctggggatgatgcatcacctcatttatggcgaaaccaccgacttctatcaccggtggatg
catagcgccaatcatgctctgggagccttctgctccggcggcactgtggccaatatcaca
gccctatggattgcccgcaaccaactgctcaaggctgacggccaatttcgcggtatcaac
cgcgaaggcttaggcgcggcgctctgccactacggttggaagggcctggcgatactggtg
tccgagcgcggccattactccctgggcaaagccgccgatctgttgggcattggccgggat
aacatagtttcaatcgcgaccgatgccaacaataaggtcgatatcgacgccatgcgcgag
gcggccaccaagctggcccggcagggcatccgagtcatggcgattatcggcgttgccggc
accacagaaaccggtaacatagatcctctacctgagctggccgagttggcaaccgagctc
aattgccactttcatgttgatgccgcttggggcggagccagcttgttatccagcaaatat
cgccatctgctcaaagggatagaactggcagactcagtggccatagatgcccataaacag
atgtatgtccctatgggggccggtatggtgctgttcaaacagcctgaactggcccgggca
attgtgcatcatgccgaatatattttgcgtaaaggttccaaggatttgggcagccagact
ctggaaggttcccgtcccggaatggccatgctggtgcatgcctgcatgcagataatcggc
aaggaaggctatgaaatactgatcaataattcgctggaaaaggcccgcttctttgccggc
ttgattgagcaacacagcgaatttgaactggtgagtgcgcccgagttgtgcctgctcacc
taccgttggtgcccctcttgggcacaaactgctctgaatcggcaattggcacagggcaat
cttgaaaaggtcaaagagatcaatggcattcttgatgacctcactcgtgccattcagaaa
aaacaacgtgaacaaggcaagtcttttgtgtcccgtacccggatccaacccgcccgatat
cacagagaaaccgtgactgtattccgggtggtgctggccaacccgctgaccacagacacc
atactggcagatgtattaaacgaacaaactgagctggcagcttctgaaaccgggctactg
caggtgctaaagcaagcctgcaactaa

DBGET integrated database retrieval system