KEGG   Shewanella algae: BS332_19110Help
Entry
BS332_19110       CDS       T05622                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
salg  Shewanella algae
Brite
Enzymes [BR:salg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BS332_19110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AXQ16029
UniProt: A0A1S2B0E2
LinkDB All DBs
Position
4226050..4226634
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTEFAGKTLEEIVKTS
SGGIFNNAAQVWNHTFYWNCLAPNGGGEATGAVAEAINAAFGSFEAFKTQFTESAVNNFG
SGWTWLVKKADGTVAIVNTSNAATPLTDASVTPLLTVDVWEHAYYIDYRNVRPDYMAHFW
QLLNWDFVNQNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacctgcattaccatatgccaagaacgcactggaaccccacatttct
caggaaaccatcgaataccactacggtaagcaccacaacacttacgtggttaagctgaac
ggtctgatcgaaggcactgaatttgccggcaagaccctggaagagattgtaaaaacctcc
agcggcggtattttcaacaacgccgctcaggtttggaaccacactttttactggaattgt
ctggcgcctaacggtggcggcgaagccaccggtgctgtagccgaagctatcaatgctgct
tttggttcttttgaagccttcaagactcagttcactgagtctgctgtcaacaactttggt
agcggctggacctggctggttaaaaaggctgatggcactgtcgctatcgttaacaccagc
aacgcggccactccgctgactgatgcttcagtgaccccactgctgaccgttgacgtttgg
gagcacgcttactacatcgactaccgtaacgttcgccctgactacatggcgcacttctgg
cagttgctgaactgggactttgttaaccaaaacttcgccggttaa

DBGET integrated database retrieval system