KEGG   Salinimonas sp. HMF8227: HMF8227_01715Help
Entry
HMF8227_01715     CDS       T05447                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
salh  Salinimonas sp. HMF8227
Brite
KEGG Orthology (KO) [BR:salh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:salh01002]
    HMF8227_01715
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salh04147]
    HMF8227_01715
   04090 CD molecules [BR:salh04090]
    HMF8227_01715
Enzymes [BR:salh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     HMF8227_01715
Peptidases [BR:salh01002]
 Metallo Peptidases
  Family M2
   HMF8227_01715
Exosome [BR:salh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMF8227_01715
CD molecules [BR:salh04090]
 Proteins
  HMF8227_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AWL12188
UniProt: A0A2S2E3G6
LinkDB All DBs
Position
1831118..1832956
Genome map
AA seq 612 aa AA seqDB search
MLKQKLTLPALMVGAVLGISGCQQESAATQDTQAKTKALTSADAKQFLKDAQTELEKLQL
PAAQAAWAYATYINRDTAAVSAYLSEKLSVRTSELAKAAAKFNDVEVDAGTRRQLNLLKN
SFVLAPPADPAKSERLSKISSELDGMYGKGKYCPSEDVCWSLGEMTSQMASVRDHEKLLD
IWQGWREVAPPMKPLYEEMVTLANEGAMDLGFADTSDLWRGKYDMPADDFAAELDRNWNQ
VKPLYEALHCHVRAELGEHYGTDVVPQDEPIPAHLLGNMWAQTWGNIYELVKPEQEMQVA
DVTQALEEQGYDEIKMVKQAESFFSSLGFEPLPETFWERSQFSKPRDRDVICHASAWNLD
DKDDLRIKMCIKKTGEEFNVIHHELGHNYYQRAYNQQPLLYRGSANDGFHEAIGDTIALS
ITPKYLKQIGLIDDIPDASNDIGMLLQVALDKIAFLPFGLMVDQWRWKVFSGEVSPEQYN
QAWWELREKYQGVQAPVERDADAFDPGAKYHVPGNTPYTRYFLAHILQFQFHKALCEIAG
DQGPIHRCSIYGSEKAGKALNDMLEMGMSKPWQDALETMTGSRQMDASTIAEYFAPLKDW
LDEQNQGRQCGW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacaaaaactcaccttgcccgccctgatggtgggagcggtattgggcatcagc
ggttgtcagcaggagtccgccgccactcaggatactcaggcaaaaaccaaagcattaacg
tcagccgacgccaaacagtttcttaaagacgctcaaaccgagctggaaaagctacagctc
ccggccgctcaggctgcctgggcctatgccacctatattaatcgagacacggctgccgtt
tctgcctatttaagcgaaaagctgtcggtgcgtacttccgagttggccaaagcagcagcc
aaatttaacgacgttgaagtggacgccggtactcgtcgtcaactgaacctgctgaaaaat
tcctttgtcctggccccacccgccgatccagctaaatccgaacgcctgtcaaaaatcagt
tcggaactggatggcatgtacggtaaaggaaagtattgcccgtctgaagatgtgtgctgg
agcctgggagaaatgaccagccaaatggccagcgtgcgcgatcatgaaaagttgctggac
atctggcaaggctggcgggaagtagcaccaccgatgaagcctctgtacgaagaaatggtc
actttggctaatgaaggagccatggatctgggctttgccgataccagcgacttgtggcga
ggcaagtatgatatgcccgccgatgactttgccgccgagttggatcgcaactggaatcag
gttaaacctctctacgaagcactgcattgccatgtgcgcgccgagctcggtgaacattat
ggtaccgatgtagtgcctcaggatgagcccatcccagcgcacctgttaggtaatatgtgg
gcccagacctggggcaatatctatgaactggtaaagcctgagcaggaaatgcaggtagct
gatgtgacgcaggcattagaagaacaaggctatgacgaaatcaagatggtcaaacaagcc
gagagcttcttctcatctctgggttttgagccgttaccggagaccttctgggagcgctcg
cagtttagtaaaccccgcgaccgggatgttatctgccacgcctcggcctggaacctggat
gacaaagacgatctgcgcatcaagatgtgcattaaaaaaaccggtgaagagtttaatgtg
attcaccacgaactgggccacaactactaccagcgtgcctacaatcagcagccgctgctg
tatcgtggctctgctaacgacggctttcacgaagccatcggcgatactatcgcattgtcg
atcacgccgaagtacctgaaacagattggtcttatcgatgacattcccgacgcttccaac
gacatcggcatgttattgcaggtagcgttggataaaatcgccttcttaccctttggtctg
atggtcgatcagtggcgctggaaagtgttctccggtgaagtaagcccagagcaatacaac
caggcctggtgggagctgcgcgagaagtaccagggcgttcaagctccggtggagcgtgat
gccgatgcctttgaccctggtgccaagtaccatgtgcccggcaatactccttacacacgc
tacttcctggcgcacattctgcagttccagttccacaaggcactgtgtgaaatcgccggt
gatcagggtccgattcaccgctgctctatctatggcagtgaaaaggccggaaaagcactc
aacgacatgctggaaatgggcatgagcaaaccctggcaggatgcgctggaaaccatgact
ggcagccgccagatggacgcctccacaattgccgagtactttgctccgttaaaagattgg
ctggatgagcaaaaccagggccgccagtgcggctggtaa

DBGET integrated database retrieval system