KEGG   Salinimonas sp. HMF8227: HMF8227_01989Help
Entry
HMF8227_01989     CDS       T05447                                 

Gene name
sod2
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
salh  Salinimonas sp. HMF8227
Brite
Enzymes [BR:salh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HMF8227_01989 (sod2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AWL12459
UniProt: A0A2S2E4D9
LinkDB All DBs
Position
2128518..2129099
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYEKNALEPHISAETLEFHYGKHHNTYVTKLNGLVEGTDMENKSLEEIIKSS
EGGVFNNAAQVWNHTFYWHSMSPNGGGEPSGAVAEAINSKWGSFADFKEAFNDKAANNFG
SGWTWLVKKADGSLDIVNTSNAGTPITDPNLTPLLTVDVWEHAYYIDYRNARPKYLEGFW
NLVNWDFANENMA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactacccgctctgccttatgaaaaaaacgcccttgagccgcacatctca
gccgagacactggaattccattacggcaaacaccacaacacctatgtcactaagctgaat
ggcctggttgaaggcactgacatggaaaacaagagcctggaagagatcatcaaatcatca
gaaggcggtgtatttaacaacgcagcccaggtttggaaccacactttctactggcacagc
atgagcccgaacggtggcggcgagccaagtggtgcggtcgccgaggccatcaacagcaag
tggggctctttcgctgactttaaagaagctttcaatgacaaagccgccaacaactttggt
tctggctggacttggctggtgaaaaaagctgacggctctctggatattgttaataccagc
aatgccggcacgcccattactgatccaaacctgacgcctctgctgaccgtggatgtgtgg
gagcatgcctactacatcgattatcgcaatgcgcgtcctaagtacctggaaggtttctgg
aacctggtcaactgggatttcgccaacgagaacatggcttaa

DBGET integrated database retrieval system