KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_02070Help
Entry
L593_02070        CDS       T02693                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
sali00564  Glycerophospholipid metabolism
sali01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sali00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    L593_02070
Enzymes [BR:sali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     L593_02070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 Pyr_redox_2 3HCDH_N NAD_binding_7 Pyr_redox NAD_binding_8 FAD_binding_2 ApbA ThiF NAD_binding_9 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGN00365
UniProt: R4VT40
LinkDB All DBs
Position
417956..419179
Genome map
AA seq 407 aa AA seqDB search
MDQPTVLVVGGGATGAGIARDLALRGVDVTLVDRDGLGSGTSGRSHGLLHSGARYAEADR
VGAEECIVENRILRDVAGECVRDTGGLFVQLADDDPAYFDAKREACESVGIPRTVLDADE
ARASVPDLADDVVRALEVPDGVMYPSRLVAANAADAREHGATMLLDAPVDGMTVEDGRIE
AVRLGGSVDERIGPEYVVNAAGAWAGRIAAMANLEVEMRPTRGVMVSVEYDDLGPVLNRC
REPDDGDIVVPHDSEVVLGTTSVAVTDPDDYATEEWEVARTYEECAAMLPPVVDAPEVRT
WWGVRPLYAPDEDERGGRGISRGFFRLDHAEDGVENLVSVVGGKLTTYRQMAEATTDLVC
ERLGVDAECTTADRRLPGADDPDRLDAFVAEFDGQGPTDEDVVHGGF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccgacagtactcgtcgtcggtggcggtgcgaccggcgccgggatcgcgcgc
gacctcgcactccggggtgtcgacgtcacgctcgtcgaccgcgacggactcggcagcggc
acctccggccgttcgcacggactgctccacagcggtgcacgctacgccgaggccgatcgg
gtcggcgccgaggagtgcatcgtggagaatcgcattctccgggacgtcgccggcgagtgc
gtccgcgacaccggcggcctcttcgtccaactcgccgacgacgacccggcgtacttcgac
gccaaacgcgaagcctgcgagtcggtcggcattccaaggacggtcctcgacgccgacgag
gccagagcgagcgtccccgacctcgccgacgacgtcgtgcgcgcgctggaagtccccgac
ggcgtgatgtatccctcgcggctggttgccgcaaatgcagccgacgcacgcgagcacggc
gcgacgatgctactcgacgcaccggtcgacggcatgaccgtcgaggacggacggatcgag
gccgtccgacttggcggctccgtcgacgaacggatcggcccggagtacgtcgtgaacgcc
gcgggtgcgtgggccggccggatcgccgcgatggcgaatctcgaggtcgagatgcgcccg
acgcgcggagtgatggtgtcggtcgagtacgacgacctcggacccgtgctgaaccgctgt
cgcgagcccgacgacggcgacatcgtcgtgccacacgactcggaagtcgttctcggaacg
acgagcgtcgcagtgacggatccggacgactacgcgaccgaggagtgggaagtagcacgc
acctacgaagagtgtgcagcgatgcttccgccggtggtggacgcacccgaagtccgcacc
tggtggggcgttcgcccgctctacgcgcccgacgaggacgagcggggcggccgtgggatc
tctcgtggattcttccggctcgaccacgcggaggacggcgtcgagaatctcgtcagcgtc
gtcggcggtaagttgacgacctatcgccagatggcggaagccaccaccgacctcgtctgt
gagcgcctgggcgtcgacgccgagtgcacgacggcggaccgtcggctgcctggcgcggac
gaccccgaccgactcgacgcgttcgtcgccgagttcgacggccaggggccgaccgacgag
gacgtggtccacggcggattctga

DBGET integrated database retrieval system