KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_06205Help
Entry
L593_06205        CDS       T02693                                 

Definition
(GenBank) cationic amino acid transporter
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Usp AA_permease_C Fumarate_red_D DUF166 Spore_permease
Motif
Other DBs
NCBI-ProteinID: AGN01190
UniProt: R4VVD5
LinkDB All DBs
Position
complement(1331847..1334207)
Genome map
AA seq 786 aa AA seqDB search
MFDITMIGIGAMIGAGIFVLTGLAAGQAGPGLVMAFAFNGFITIFTGMVYAELGSAIPEA
GGGYLWVREALGRSQAFLAGWMSWFAHAVAGSLYVLGFGAFVHLLLTDYFGIQLFQPIDL
LFITFGPEKLFAVFAGALFAYINYRGAKETGLAGNIVTMVKVTVIVVLIAFGFGYILGNP
GQSTERFRPFLPRDFGGVFIAMGLTFIAFEGYEIIVQSGEEVVNPKKAVPKAVFYSMSVV
VTIYMLVAIVLIGAVSVTPELFSLAQEGAASGGHGATNLPPVPDDIADAAVWEILGHLGE
LGLARAAGQIMPYGTLVILVAGIFSTLSALNATTYSSTRVSFAMGRDHVLPDAFSAVHPE
KKTPHIATALSGALIVFMAVALPIEAVAAATDVMFLLLFLQVNYAAIVIRREWGDQIDYG
YVMPFFPYVPIIGILTKLALAVYLFNYSPLAWYGAIAWILVGVGIFFLYSRSRVRETEAK
EETRLIAEERSPEERGYQVLVPIANPDHAEQLIRAGSAIARRQDGEVLLTSVATVPDQTP
LSEGSRYADEQRELLDEAMQYAPEDVPVHQTVTIGHDIAKSINNVAYQRDSDLVLLGWRG
QRKRMSDYALGSNIDTVVENAECDVAVLKTDGTTDSRRVLVPTAGGSNSDLAEMVAAAYV
EAGSEVTLFHVATDRDVESAQSFLEQRQAALAESDIDVDITVEAGEDISEGILEYARNGD
FDSIIVGAAGEGILRRVLFGEVPETVGAEFEGEVVMVRKHRPVQSAVKRLVGKWVGKGAK
ATNLGE
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgacatcacgatgatcggcatcggcgcgatgattggcgctgggatattcgtcttg
accggtcttgcagccggtcaggccggtcccggtctcgtgatggccttcgcgttcaacggc
ttcatcaccattttcaccgggatggtgtacgcggagctcgggtccgccatcccggaagcg
ggtggcggctatctctgggtacgggaagccctgggacggtctcaggcgttcctcgctggc
tggatgtcgtggttcgcccacgctgtcgcaggttcactgtacgtgctcggcttcggtgcg
ttcgtgcatctcctgttgacggactacttcggaatccagctcttccagccgattgatctc
ctgttcatcacgttcggccccgagaagctattcgcagtgtttgctggcgcactgttcgcg
tacatcaactaccgtggcgcgaaggagaccggcctcgccgggaacatcgtgacgatggtc
aaggtcacggtgatcgtcgttcttatcgccttcgggttcgggtacattttggggaatccg
gggcaatccaccgagcggttccgccccttcctcccccgtgacttcggcggggtcttcatc
gccatggggctgaccttcatcgcattcgagggctacgagatcatcgtgcagtccggcgag
gaagtcgtcaatcccaagaaagcggttccgaaggcagtgttctactcgatgtccgtggtg
gtcaccatctacatgctggtagcgatcgttctcatcggcgccgtctctgtcacgccggaa
ctattctcgctcgcacaggagggtgcggcctcggggggtcacggtgcgacgaacctgcca
ccggttcctgacgacatcgcggacgcggcggtctgggagattctcggccacctcggcgaa
ctggggctcgcccgggcggccggtcagattatgccctacgggacgctcgtcattctggtc
gcgggtatcttctcgacgctctctgcgctcaacgccacgacgtactcctcgacacgcgtc
tccttcgccatggggcgtgaccacgtccttccggacgcgttcagtgcggtccatcccgag
aagaagacgccacacatcgcgacggctctttccggcgcgctcatcgtcttcatggcggtc
gcacttcccatcgaggcagtcgctgccgcgactgacgtcatgttcctcctgctgttcttg
caggtcaactacgctgccatcgtgatccgccgtgagtggggcgatcaaatcgactacggt
tacgtgatgccgttcttcccgtacgtccccatcatcggcattctgaccaaactcgcgctt
gcagtctacctgttcaactacagtccgctcgcgtggtacggggcaatcgcctggattctc
gtcggggtcggaatcttcttcctctactcccggagtcgcgtccgtgagaccgaagcaaaa
gaggagacccgccttatcgcggaagaacggtctcccgaagaacgtgggtatcaggttctc
gttccgattgcgaaccccgaccacgccgaacagctgattcgtgcgggtagtgctatcgct
cgacgccaggatggcgaagtcctgctaacgagcgttgcgaccgtccctgatcagacgccg
ctgtcggaggggagtcggtacgccgacgaacagcgggagttgctcgacgaagcgatgcag
tacgcgcccgaggacgtcccggttcaccagaccgtgaccatcggccacgacatcgccaaa
agcatcaacaacgtcgcctatcagcgtgacagcgacctcgtgttgctcggatggcgtggt
cagcgcaaacggatgtccgattacgcgctggggtccaacatcgacacggtcgtcgagaac
gccgagtgtgacgtcgccgtgctcaagacggacgggacgacggactcgaggcgcgtcctc
gttccgactgcggggggatcgaactccgatctcgccgagatggtcgccgccgcgtacgtg
gaggctggtagcgaggtcacactgttccacgtggcgaccgaccgcgacgtcgagagcgcg
cagtcgttcctcgagcagaggcaggcagcactcgccgagtccgacatcgacgtcgacatc
accgtcgaagcgggcgaggacatctcggagggaatcctcgaatacgcgcgcaacggcgac
ttcgactcgatcatcgtcggtgcggcgggcgagggcatccttcgccgcgtgttattcggt
gaagtccccgagactgtgggcgccgagttcgaaggggaggtcgtaatggtacggaaacat
cgcccggtccagtcggccgtcaaacgactggtcgggaaatgggtcggcaagggggcaaag
gcgacgaacctgggtgagtga

DBGET integrated database retrieval system