KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_14285Help
Entry
L593_14285        CDS       T02693                                 

Definition
(GenBank) Zn-dependent oxidoreductase/NADPH2:quinone reductase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
sali00040  Pentose and glucuronate interconversions
sali00051  Fructose and mannose metabolism
sali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L593_14285
   00051 Fructose and mannose metabolism
    L593_14285
Enzymes [BR:sali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     L593_14285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGN02796
UniProt: R4W2A8
LinkDB All DBs
Position
complement(3074566..3075603)
Genome map
AA seq 345 aa AA seqDB search
MRAAVLHEPDRIELEDREAPAPGPDEVVVDVGAIGICGSDLHYYEHGRIGDYVVESPLVL
GHESAGVVAAVGSDVESHSVGDRVALEPGVPCRRCEYCRSGRYNLCPDVTFMATPPDDGA
FVESVAWPADYAFTLPDAVSLTEGALAEPVSVGVHACRRGDVGAGDSVLVTGAGPIGLLA
ADVAEAFGATEVTISEPVDRKREIAADRGATRTVDPVADDVQSAVGGTGDGGPDVAIEAT
GDPAALQDCIDSVRRGGTVVCVGLGAESELSLDVVDLVDDELTLAGCFRYANTYPTAISL
LADGQIDAAGLVDFEAPLEETADAMERALDPTLVKGMIEIDEADA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttctacacgaaccggatcggatcgaactcgaggaccgcgaagcgcct
gcgcctggccccgacgaggtcgtcgtcgacgtcggcgcgatcggcatctgtggctcggac
ctgcactactacgaacacggtcgcatcggcgactacgtcgtggagtccccgctcgtcctc
ggccacgaatctgcaggggtcgtcgctgccgttgggagcgacgtcgagagccacagcgtt
ggggatcgcgtcgcgctagagcctggcgtcccctgccgtcggtgcgagtactgccgatcg
ggtcgctacaatctctgtccggacgtgaccttcatggccacgccgccggacgacggggcg
ttcgtggagtccgtcgcctggccagccgactacgccttcacgctccctgacgcggtcagt
cttacagagggcgcgctcgcggagcccgtgagcgtcggcgtccacgcttgccgccggggc
gacgtcggcgcgggagacagcgtgctcgtgaccggcgcggggccgatcggcctcctcgcc
gcggacgtggccgaggccttcggcgcgacggaggtcacgatctccgagccagtcgatcgc
aagcgggagatcgccgccgatcgcggcgcgacgagaacggtcgatcccgtcgccgacgac
gtccagtcggcagtcggtggaaccggcgacggcggccccgacgtcgcgatcgaggcgacc
ggcgacccggcagccctgcaggactgcatcgattccgtccgacgaggcggcaccgtcgtc
tgcgtgggattgggcgccgagtcggagctctccctcgacgtggtcgacctcgtcgacgac
gaactgacgctcgccggctgtttccgctacgccaacacgtacccgacggcgatctcgctg
ctcgccgacggccagatcgacgccgcaggcctcgttgacttcgaagcgccactcgaggag
accgccgacgccatggagcgagcgctcgatccgacgctggtcaaggggatgatcgaaatc
gacgaggcggacgcctga

DBGET integrated database retrieval system