KEGG   Streptomyces albireticuli: SMD11_1365Help
Entry
SMD11_1365        CDS       T05230                                 

Gene name
puuE
Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
salj  Streptomyces albireticuli
Pathway
salj00250  Alanine, aspartate and glutamate metabolism
salj00410  beta-Alanine metabolism
salj00640  Propanoate metabolism
salj00650  Butanoate metabolism
salj01100  Metabolic pathways
salj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:salj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMD11_1365 (puuE)
   00650 Butanoate metabolism
    SMD11_1365 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMD11_1365 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMD11_1365 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salj01007]
    SMD11_1365 (puuE)
Enzymes [BR:salj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SMD11_1365 (puuE)
Amino acid related enzymes [BR:salj01007]
 Aminotransferase (transaminase)
  Class III
   SMD11_1365 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ARZ67026
UniProt: A0A1Z2KYC7
LinkDB All DBs
Position
complement(1510548..1511897)
Genome map
AA seq 449 aa AA seqDB search
MSPGSEPPPPGGAPATHLHARHRAVMPDWLALYYREPLELTHGEGRHVWDSAGRRYLDFF
GGILTTMTAHALPEVTKAVTEQAARILHTSTLYLDRHMVEFAERIAALSGIPDARVFFTS
SGTEATDAALLLATAHRRSNQILAMRNSYHGRSFSAVGVTGNSAWSPTSLSPLQTLYVHG
AVRTRGPYAALSDAEFTAACVADLEDVLGQAHGNVAALIAEPVQGVGGFTSPPDGLYAAF
REVLARRGILWISDEVQTGWGRTGDHFWGWQAHAASGPPDLLTFAKGIGNGMSIGGVVAR
AEVMNSLGANSISTFGGSPVTMAAGLANLTHLLEHDLQGNARRVGGLLIERLRAVAAGLP
LVREVRGRGLMIGVELAGPDGSPSPEAAALTLEHAREGGLLIGKGGREAGTLRIAPPLSL
TVAEAEEGAAVLETALHRTHSALAGEERA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgggagcgagccgccaccgcccggcggcgcccccgcgacgcacctccacgcc
cggcaccgtgccgtcatgcccgactggctcgccctctactaccgcgagcccctggagctc
acccacggcgagggccggcacgtctgggactccgccggccgccgctacctcgacttcttc
ggcggcatcctcaccaccatgaccgcccacgccctccccgaggtcaccaaggccgtcacc
gagcaggccgcgcgcatcctgcacacctccaccctttacctcgaccggcacatggtggag
ttcgccgagcggatcgccgccctctccggcatcccggacgcccgcgtcttcttcacctcc
tccggtaccgaggccaccgacgccgccctgctgctcgccaccgcccaccgccgctccaac
cagatcctggcgatgcgcaacagctaccacggccgctccttctccgcggtcggcgtcacg
ggcaactccgcctggtcgcccaccagcctctccccgctccagacgctctacgtccacggc
gccgtccgcacccgcggcccgtacgccgccctgagcgacgcggagttcaccgcggcctgc
gtcgccgacctggaggacgtcctcggccaggcgcacggcaacgtcgccgcgctcatcgcc
gaacccgtccagggcgtcggcgggttcacctccccgcccgacgggctctacgccgccttc
cgcgaggtcctcgcgcggcgcggcatcctctggatctccgacgaggtgcagaccggctgg
ggccgcaccggcgaccacttctggggctggcaggcccacgccgcgagcggcccgcccgac
ctgctcaccttcgccaagggcatcgggaacggcatgtcgatcggcggcgtcgtcgcccgc
gccgaggtgatgaactccctgggcgccaactccatctccaccttcggcggcagccccgtc
accatggccgccggactcgccaacctcacccacctcctggagcacgacctccagggcaac
gcccgccgcgtcggcggcctcctcatcgagcggctccgcgccgtcgccgccggcctgccc
ctcgtccgcgaggtgcgcggccggggcctgatgatcggcgtcgagctggccggccccgac
ggctcgccctcgcccgaggccgccgccctcaccctcgaacacgcccgtgagggcggcctg
ctgatcggcaagggcggccgcgaggccggcaccctgcggatcgccccgccgctgtccctc
accgtcgccgaggccgaggagggcgcggccgtcctcgaaaccgccctgcaccgcacgcac
agcgccctcgccggagaggaacgggcatga

DBGET integrated database retrieval system